Otolemur garnettii (small-eared galago): 100952751 Help Entry 100952751         CDS       T07855                                  Symbol GSK3B Name (RefSeq) glycogen synthase kinase-3 beta   KO K03083   glycogen synthase kinase 3 beta [EC:2.7.11.26] Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01521   EGFR tyrosine kinase inhibitor resistance oga04012   ErbB signaling pathway oga04062   Chemokine signaling pathway oga04110   Cell cycle oga04150   mTOR signaling pathway oga04151   PI3K-Akt signaling pathway oga04310   Wnt signaling pathway oga04340   Hedgehog signaling pathway oga04360   Axon guidance oga04390   Hippo signaling pathway oga04510   Focal adhesion oga04517   IgSF CAM signaling oga04550   Signaling pathways regulating pluripotency of stem cells oga04657   IL-17 signaling pathway oga04660   T cell receptor signaling pathway oga04662   B cell receptor signaling pathway oga04722   Neurotrophin signaling pathway oga04728   Dopaminergic synapse oga04910   Insulin signaling pathway oga04916   Melanogenesis oga04917   Prolactin signaling pathway oga04919   Thyroid hormone signaling pathway oga04931   Insulin resistance oga04932   Non-alcoholic fatty liver disease oga04934   Cushing syndrome oga04935   Growth hormone synthesis, secretion and action oga04936   Alcoholic liver disease oga05010   Alzheimer disease oga05020   Prion disease oga05022   Pathways of neurodegeneration - multiple diseases oga05135   Yersinia infection oga05160   Hepatitis C oga05162   Measles oga05163   Human cytomegalovirus infection oga05165   Human papillomavirus infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05200   Pathways in cancer oga05210   Colorectal cancer oga05213   Endometrial cancer oga05215   Prostate cancer oga05217   Basal cell carcinoma oga05224   Breast cancer oga05225   Hepatocellular carcinoma oga05226   Gastric cancer oga05415   Diabetic cardiomyopathy oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04012 ErbB signaling pathway     100952751 (GSK3B)    04310 Wnt signaling pathway     100952751 (GSK3B)    04340 Hedgehog signaling pathway     100952751 (GSK3B)    04390 Hippo signaling pathway     100952751 (GSK3B)    04151 PI3K-Akt signaling pathway     100952751 (GSK3B)    04150 mTOR signaling pathway     100952751 (GSK3B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100952751 (GSK3B)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100952751 (GSK3B)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100952751 (GSK3B)    04550 Signaling pathways regulating pluripotency of stem cells     100952751 (GSK3B)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100952751 (GSK3B)    04657 IL-17 signaling pathway     100952751 (GSK3B)    04662 B cell receptor signaling pathway     100952751 (GSK3B)    04062 Chemokine signaling pathway     100952751 (GSK3B)   09152 Endocrine system    04910 Insulin signaling pathway     100952751 (GSK3B)    04917 Prolactin signaling pathway     100952751 (GSK3B)    04935 Growth hormone synthesis, secretion and action     100952751 (GSK3B)    04919 Thyroid hormone signaling pathway     100952751 (GSK3B)    04916 Melanogenesis     100952751 (GSK3B)   09156 Nervous system    04728 Dopaminergic synapse     100952751 (GSK3B)    04722 Neurotrophin signaling pathway     100952751 (GSK3B)   09158 Development and regeneration    04360 Axon guidance     100952751 (GSK3B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100952751 (GSK3B)   09162 Cancer: specific types    05210 Colorectal cancer     100952751 (GSK3B)    05225 Hepatocellular carcinoma     100952751 (GSK3B)    05226 Gastric cancer     100952751 (GSK3B)    05217 Basal cell carcinoma     100952751 (GSK3B)    05215 Prostate cancer     100952751 (GSK3B)    05213 Endometrial cancer     100952751 (GSK3B)    05224 Breast cancer     100952751 (GSK3B)   09172 Infectious disease: viral    05160 Hepatitis C     100952751 (GSK3B)    05162 Measles     100952751 (GSK3B)    05163 Human cytomegalovirus infection     100952751 (GSK3B)    05167 Kaposi sarcoma-associated herpesvirus infection     100952751 (GSK3B)    05165 Human papillomavirus infection     100952751 (GSK3B)   09171 Infectious disease: bacterial    05135 Yersinia infection     100952751 (GSK3B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100952751 (GSK3B)    05020 Prion disease     100952751 (GSK3B)    05022 Pathways of neurodegeneration - multiple diseases     100952751 (GSK3B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100952751 (GSK3B)    05415 Diabetic cardiomyopathy     100952751 (GSK3B)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100952751 (GSK3B)    04932 Non-alcoholic fatty liver disease     100952751 (GSK3B)    04931 Insulin resistance     100952751 (GSK3B)    04934 Cushing syndrome     100952751 (GSK3B)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100952751 (GSK3B)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:oga01001]     100952751 (GSK3B)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100952751 (GSK3B) Enzymes [BR:oga01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.26  tau-protein kinase      100952751 (GSK3B) Protein kinases [BR:oga01001]  Serine/threonine kinases: CMGC group   GSK family [OT]    100952751 (GSK3B) Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     100952751 (GSK3B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Motif Other DBs NCBI-GeneID:  100952751 NCBI-ProteinID:  XP_023372068 LinkDB All DBs Position Unknown AA seq 401 aa AA seqDB search MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKVCKNVTISHFRKYLLISAFYF FFISAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPG DSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSR LLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIP PHARIQAAGSTPTNATAASDANAGDRGQTNNAASASASNST NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt atgtcagggaggcctagaaccacctcctttgcggagagctgcaagccagtgcagcagcct tcggcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagatactaaa gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa ctggttgccatcaagaaagtattgcaggacaaaagatttaagaaccgagagctccagatc atgagaaaactagatcactgtaacatagtgcgattgcgttatttcttctactccagtggt gagaagaaagacgaagtctatcttaatctggtgctggactatgttccggaaacagtatac agagttgccagacactatagtcgagccaaacagacactccctgtgatctatgtcaaggta tgtaaaaatgtaacaatttcccattttagaaaatatttactaatttctgctttttatttt ttttttattagtgcaaagcagctggtccgaggagaacccaatgtttcctatatctgttct cggtactatagggcaccagagttgatctttggagccactgattatacctctagtatagat gtatggtctgctggctgtgtgttggctgagctgttgctaggacaaccaatatttccaggg gacagtggggtagatcagttggtggaaataatcaaggtcctgggaacgccaacaagggag caaattagagaaatgaacccaaactacacagaattcaaatttccccaaattaaggcacat ccttggactaaggtcttccgaccccgaactccaccagaggcaattgcactgtgtagccgt ctgctggagtatacaccaactgcccgattaacaccactggaagcttgtgcacattcattt tttgatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactc ttcaacttcaccacacaagaactatcaagtaatccacctctggctaccatccttattcct cctcatgcacggattcaagcagctggttcaacccccacaaatgccacagcagcctcagat gctaatgctggagaccgtggacagaccaataatgccgcttctgcatcagcttccaactcc acctga

DBGET integrated database retrieval system