Otolemur garnettii (small-eared galago): 100952803 Help Entry 100952803         CDS       T07855                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04014   Ras signaling pathway oga04015   Rap1 signaling pathway oga04020   Calcium signaling pathway oga04022   cGMP-PKG signaling pathway oga04024   cAMP signaling pathway oga04070   Phosphatidylinositol signaling system oga04114   Oocyte meiosis oga04218   Cellular senescence oga04261   Adrenergic signaling in cardiomyocytes oga04270   Vascular smooth muscle contraction oga04371   Apelin signaling pathway oga04625   C-type lectin receptor signaling pathway oga04713   Circadian entrainment oga04720   Long-term potentiation oga04722   Neurotrophin signaling pathway oga04728   Dopaminergic synapse oga04740   Olfactory transduction oga04744   Phototransduction oga04750   Inflammatory mediator regulation of TRP channels oga04910   Insulin signaling pathway oga04912   GnRH signaling pathway oga04915   Estrogen signaling pathway oga04916   Melanogenesis oga04921   Oxytocin signaling pathway oga04922   Glucagon signaling pathway oga04924   Renin secretion oga04925   Aldosterone synthesis and secretion oga04970   Salivary secretion oga04971   Gastric acid secretion oga05010   Alzheimer disease oga05012   Parkinson disease oga05022   Pathways of neurodegeneration - multiple diseases oga05031   Amphetamine addiction oga05034   Alcoholism oga05133   Pertussis oga05152   Tuberculosis oga05163   Human cytomegalovirus infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05170   Human immunodeficiency virus 1 infection oga05200   Pathways in cancer oga05214   Glioma oga05417   Lipid and atherosclerosis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100952803    04015 Rap1 signaling pathway     100952803    04371 Apelin signaling pathway     100952803    04020 Calcium signaling pathway     100952803    04070 Phosphatidylinositol signaling system     100952803    04024 cAMP signaling pathway     100952803    04022 cGMP-PKG signaling pathway     100952803  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100952803    04218 Cellular senescence     100952803  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100952803   09152 Endocrine system    04910 Insulin signaling pathway     100952803    04922 Glucagon signaling pathway     100952803    04912 GnRH signaling pathway     100952803    04915 Estrogen signaling pathway     100952803    04921 Oxytocin signaling pathway     100952803    04916 Melanogenesis     100952803    04924 Renin secretion     100952803    04925 Aldosterone synthesis and secretion     100952803   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100952803    04270 Vascular smooth muscle contraction     100952803   09154 Digestive system    04970 Salivary secretion     100952803    04971 Gastric acid secretion     100952803   09156 Nervous system    04728 Dopaminergic synapse     100952803    04720 Long-term potentiation     100952803    04722 Neurotrophin signaling pathway     100952803   09157 Sensory system    04744 Phototransduction     100952803    04740 Olfactory transduction     100952803    04750 Inflammatory mediator regulation of TRP channels     100952803   09159 Environmental adaptation    04713 Circadian entrainment     100952803  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100952803   09162 Cancer: specific types    05214 Glioma     100952803   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100952803    05163 Human cytomegalovirus infection     100952803    05167 Kaposi sarcoma-associated herpesvirus infection     100952803   09171 Infectious disease: bacterial    05133 Pertussis     100952803    05152 Tuberculosis     100952803   09164 Neurodegenerative disease    05010 Alzheimer disease     100952803    05012 Parkinson disease     100952803    05022 Pathways of neurodegeneration - multiple diseases     100952803   09165 Substance dependence    05031 Amphetamine addiction     100952803    05034 Alcoholism     100952803   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100952803    05418 Fluid shear stress and atherosclerosis     100952803  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oga01009]     100952803   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100952803    03036 Chromosome and associated proteins [BR:oga03036]     100952803   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100952803 Protein phosphatases and associated proteins [BR:oga01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100952803 Membrane trafficking [BR:oga04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100952803 Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100952803 Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100952803 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen UPF0154 Dockerin_1 DUF1103 DUF5580_M FCaBP_EF-hand SPEF2_C PA_Ig-like PhageMin_Tail SurA_N_3 SurA_N_2 Motif Other DBs NCBI-GeneID:  100952803 NCBI-ProteinID:  XP_023364304 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGGGTITTKELGTVMRSLGKNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIKEAFRVFDKDGNGYISATELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaattgactgaagagcagattgcagaattcaaagaagctttttcactattt gacaaggatggtggtggaactataacaacaaaggaattgggaactgtaatgaggtctctt ggaaagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt aatggcacaattgatttccctgaatttctgacaatgatggcaagaaaaatgaaagacaca gacagtgaagaagaaattaaagaagcattccgtgtgtttgataaggatggcaatggctat atcagtgcaacagagcttcgccatgtgatgacaaacctcggagagaagttaacagatgaa gaggttgacgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system