Otolemur garnettii (small-eared galago): 100952943 Help Entry 100952943         CDS       T07855                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga03272   Virion - Hepatitis viruses oga04382   Cornified envelope formation oga04514   Cell adhesion molecules oga04530   Tight junction oga04670   Leukocyte transendothelial migration oga05160   Hepatitis C Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     100952943 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     100952943 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     100952943 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100952943 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     100952943 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     100952943 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oga03037]     100952943 (CLDN1)    04147 Exosome [BR:oga04147]     100952943 (CLDN1)    04515 Cell adhesion molecules [BR:oga04515]     100952943 (CLDN1) Cilium and associated proteins [BR:oga03037]  Other cilia and associated proteins   Stereociliary proteins    100952943 (CLDN1) Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    100952943 (CLDN1)   Exosomal proteins of colorectal cancer cells    100952943 (CLDN1) Cell adhesion molecules [BR:oga04515]  Immunoglobulin superfamily   L1 family    100952943 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC SUR7 Cytochrom_B_C DUF2207_C TMEM174 DUF4064 CD20 DUF2613 Motif Other DBs NCBI-GeneID:  100952943 NCBI-ProteinID:  XP_003792751 Ensembl:  ENSOGAG00000008451 UniProt:  H0WYH9 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGAIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLTSTLQATRALMVVGILLGLIAIFVATIGMKCMKCLEDDEVQKMRMAV IGGVIFLIAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCCCPEKTTSYPTPRPYPKPTPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcgggactgcagttattgggcttcatcctagccttcctgggctggatcggc gccatcgtcagcactgccctgccccagtggaagatttactcctacgccggcgacaacatc gtgaccgcccaggcgatctatgaggggctgtggatgtcctgcgtgtcgcagagcactggg cagatccagtgcaaagtcttcgactccttgctgaatctgaccagcactttgcaagcaacc cgtgctttgatggtggttggaatcctcctgggactgatagcaatttttgtggccaccatt ggcatgaagtgtatgaaatgcctggaagatgatgaggtgcagaagatgcggatggctgtc attgggggcgtgatatttcttatcgcaggtctggctattttagttgccacagcatggtat ggcaatagaattgttcaagaattctatgaccccatgactccagtcaatgccaggtacgaa tttggccaggcgctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc ctcctctgctgctgctgtcctgaaaaaacaacctcttacccaacaccgcggccctatcca aaacctacaccttccagtgggaaagactacgtgtga

DBGET integrated database retrieval system