Otolemur garnettii (small-eared galago): 100953032 Help Entry 100953032         CDS       T07855                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01521   EGFR tyrosine kinase inhibitor resistance oga01524   Platinum drug resistance oga04014   Ras signaling pathway oga04064   NF-kappa B signaling pathway oga04115   p53 signaling pathway oga04137   Mitophagy - animal oga04140   Autophagy - animal oga04151   PI3K-Akt signaling pathway oga04210   Apoptosis oga04215   Apoptosis - multiple species oga04621   NOD-like receptor signaling pathway oga04630   JAK-STAT signaling pathway oga05012   Parkinson disease oga05014   Amyotrophic lateral sclerosis oga05022   Pathways of neurodegeneration - multiple diseases oga05145   Toxoplasmosis oga05162   Measles oga05166   Human T-cell leukemia virus 1 infection oga05168   Herpes simplex virus 1 infection oga05170   Human immunodeficiency virus 1 infection oga05200   Pathways in cancer oga05202   Transcriptional misregulation in cancer oga05212   Pancreatic cancer oga05220   Chronic myeloid leukemia oga05222   Small cell lung cancer oga05225   Hepatocellular carcinoma oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100953032 (BCL2L1)    04630 JAK-STAT signaling pathway     100953032 (BCL2L1)    04064 NF-kappa B signaling pathway     100953032 (BCL2L1)    04151 PI3K-Akt signaling pathway     100953032 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100953032 (BCL2L1)    04137 Mitophagy - animal     100953032 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     100953032 (BCL2L1)    04215 Apoptosis - multiple species     100953032 (BCL2L1)    04115 p53 signaling pathway     100953032 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100953032 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100953032 (BCL2L1)    05202 Transcriptional misregulation in cancer     100953032 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     100953032 (BCL2L1)    05225 Hepatocellular carcinoma     100953032 (BCL2L1)    05220 Chronic myeloid leukemia     100953032 (BCL2L1)    05222 Small cell lung cancer     100953032 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100953032 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     100953032 (BCL2L1)    05162 Measles     100953032 (BCL2L1)    05168 Herpes simplex virus 1 infection     100953032 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100953032 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     100953032 (BCL2L1)    05014 Amyotrophic lateral sclerosis     100953032 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     100953032 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100953032 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100953032 (BCL2L1)    01524 Platinum drug resistance     100953032 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oga01009]     100953032 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100953032 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:oga02000]     100953032 (BCL2L1) Protein phosphatases and associated proteins [BR:oga01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100953032 (BCL2L1) Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100953032 (BCL2L1) Transporters [BR:oga02000]  Other transporters   Pores ion channels [TC:1]    100953032 (BCL2L1) SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100953032 NCBI-ProteinID:  XP_012659534 LinkDB All DBs Position Unknown AA seq 203 aa AA seqDB search MSQSNRELVVDFISYKLSQKGYSWSQFSDVEENRTEAPEGNESELETPSAINGNPSWHLA DSPTVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWVRTKPFVCPFLWPLV NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttatctcctacaagctttcccagaaa ggatacagctggagtcagtttagcgatgtggaagagaacaggactgaggccccagaaggg aatgaatcagagctggagacccccagtgccattaatggcaacccatcctggcacctggct gacagccccacggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtgaagcaagcactgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatctcagctgcacatcaccccagggacagcatat cagagctttgaacaggtagtgaacgaactcttccgggatggggtaaactggggtcgaatt gtggcctttttctccttcggcggggctctgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacttgaatgaccacctagagcct tggatccaggagaacggcggctgggtaagaaccaagccctttgtgtgtccttttctttgg cctttggtttga

DBGET integrated database retrieval system