Otolemur garnettii (small-eared galago): 100954526 Help Entry 100954526         CDS       T07855                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04140   Autophagy - animal oga04144   Endocytosis oga04152   AMPK signaling pathway oga04530   Tight junction oga04972   Pancreatic secretion oga05014   Amyotrophic lateral sclerosis oga05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     100954526 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100954526 (RAB8A)    04140 Autophagy - animal     100954526 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     100954526 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     100954526 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100954526 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     100954526 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100954526 (RAB8A)    03036 Chromosome and associated proteins [BR:oga03036]     100954526 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100954526 (RAB8A)    04031 GTP-binding proteins [BR:oga04031]     100954526 (RAB8A) Membrane trafficking [BR:oga04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     100954526 (RAB8A)  Autophagy   Other autophagy associated proteins     100954526 (RAB8A) Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100954526 (RAB8A) Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100954526 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    100954526 (RAB8A)   Exosomal proteins of colorectal cancer cells    100954526 (RAB8A) GTP-binding proteins [BR:oga04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     100954526 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf DUF3963 AAA_7 Motif Other DBs NCBI-GeneID:  100954526 NCBI-ProteinID:  XP_012664839 Ensembl:  ENSOGAG00000013894 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDRRQVSKERGEKLA LDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSS FFRCVLL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgtttaagctgctgctcatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctctgaggacgccttcaactccactttcatctccacc ataggaattgactttaagattaggaccatagagctcgatggcaaaagaattaaactacag atatggggcatcatgctggtctacgacatcaccaatgagaagtcctttgacaacatccgg aactggattcgaaacattgaagagcacgcctctgcagatgtcgaaaagatgatactcggg aacaagtgtgatgtgaatgacaggagacaagtttccaaggaacgaggagaaaagctggcc ctcgactatggaatcaagttcatggagaccagtgcaaaggccaacatcaacgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccaaggagtcaaaatcacgccagaccagcagaaaaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system