Otolemur garnettii (small-eared galago): 100954615 Help Entry 100954615         CDS       T07855                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04066   HIF-1 signaling pathway oga04120   Ubiquitin mediated proteolysis oga05170   Human immunodeficiency virus 1 infection oga05200   Pathways in cancer oga05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100954615 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     100954615 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100954615 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     100954615 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100954615 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oga04121]     100954615 (ELOB)    03400 DNA repair and recombination proteins [BR:oga03400]     100954615 (ELOB) Ubiquitin system [BR:oga04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      100954615 (ELOB)    Cul5 complex      100954615 (ELOB) DNA repair and recombination proteins [BR:oga03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      100954615 (ELOB) SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  100954615 NCBI-ProteinID:  XP_012661152 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MASQEAQESGHLVSHPQPRRNQDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDA FEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggccagccaagaggctcaggagtctgggcacttggtgtcacaccctcagcccaggagg aatcaggatgaccagctcctggatgatggcaagacactgggcgaatgtggcttcaccagc caaacagcacggccacaggcccctgccacagtagggctggccttcagggcagatgatgcc tttgaggccctacgcattgagcccttctccagcccaccagagctacccgatgtgatgaaa ccccaggactcaggaagcagcgccaatgaacaggctgtacagtga

DBGET integrated database retrieval system