Otolemur garnettii (small-eared galago): 100954771 Help Entry 100954771         CDS       T07855                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04014   Ras signaling pathway oga04015   Rap1 signaling pathway oga04022   cGMP-PKG signaling pathway oga04024   cAMP signaling pathway oga04062   Chemokine signaling pathway oga04071   Sphingolipid signaling pathway oga04072   Phospholipase D signaling pathway oga04081   Hormone signaling oga04144   Endocytosis oga04150   mTOR signaling pathway oga04270   Vascular smooth muscle contraction oga04310   Wnt signaling pathway oga04350   TGF-beta signaling pathway oga04360   Axon guidance oga04510   Focal adhesion oga04520   Adherens junction oga04530   Tight junction oga04611   Platelet activation oga04621   NOD-like receptor signaling pathway oga04625   C-type lectin receptor signaling pathway oga04660   T cell receptor signaling pathway oga04670   Leukocyte transendothelial migration oga04722   Neurotrophin signaling pathway oga04810   Regulation of actin cytoskeleton oga04921   Oxytocin signaling pathway oga04928   Parathyroid hormone synthesis, secretion and action oga04972   Pancreatic secretion oga05100   Bacterial invasion of epithelial cells oga05132   Salmonella infection oga05133   Pertussis oga05135   Yersinia infection oga05152   Tuberculosis oga05163   Human cytomegalovirus infection oga05200   Pathways in cancer oga05203   Viral carcinogenesis oga05205   Proteoglycans in cancer oga05206   MicroRNAs in cancer oga05210   Colorectal cancer oga05417   Lipid and atherosclerosis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100954771 (RHOA)    04015 Rap1 signaling pathway     100954771 (RHOA)    04310 Wnt signaling pathway     100954771 (RHOA)    04350 TGF-beta signaling pathway     100954771 (RHOA)    04072 Phospholipase D signaling pathway     100954771 (RHOA)    04071 Sphingolipid signaling pathway     100954771 (RHOA)    04024 cAMP signaling pathway     100954771 (RHOA)    04022 cGMP-PKG signaling pathway     100954771 (RHOA)    04150 mTOR signaling pathway     100954771 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     100954771 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100954771 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100954771 (RHOA)    04520 Adherens junction     100954771 (RHOA)    04530 Tight junction     100954771 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100954771 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100954771 (RHOA)    04621 NOD-like receptor signaling pathway     100954771 (RHOA)    04625 C-type lectin receptor signaling pathway     100954771 (RHOA)    04660 T cell receptor signaling pathway     100954771 (RHOA)    04670 Leukocyte transendothelial migration     100954771 (RHOA)    04062 Chemokine signaling pathway     100954771 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     100954771 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     100954771 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100954771 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     100954771 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100954771 (RHOA)   09158 Development and regeneration    04360 Axon guidance     100954771 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100954771 (RHOA)    05206 MicroRNAs in cancer     100954771 (RHOA)    05205 Proteoglycans in cancer     100954771 (RHOA)    05203 Viral carcinogenesis     100954771 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     100954771 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100954771 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100954771 (RHOA)    05135 Yersinia infection     100954771 (RHOA)    05133 Pertussis     100954771 (RHOA)    05152 Tuberculosis     100954771 (RHOA)    05100 Bacterial invasion of epithelial cells     100954771 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100954771 (RHOA)    05418 Fluid shear stress and atherosclerosis     100954771 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100954771 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100954771 (RHOA)    04031 GTP-binding proteins [BR:oga04031]     100954771 (RHOA) Membrane trafficking [BR:oga04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100954771 (RHOA) Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100954771 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100954771 (RHOA)   Exosomal proteins of colorectal cancer cells    100954771 (RHOA)   Exosomal proteins of bladder cancer cells    100954771 (RHOA) GTP-binding proteins [BR:oga04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100954771 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU VASP_tetra Motif Other DBs NCBI-GeneID:  100954771 NCBI-ProteinID:  XP_003800635 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKP EEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtgtttctccatcgacagccctgatagtttagaaaacatcccagaaaaatggacccca gaagtcaagcatttctgccccaatgtgcccatcatcctggttgggaacaagaaggatctt cggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagcctgtaaaacct gaagaaggaagagatatggcaaacaggattggtgcttttgggtacatggagtgttcagca aagaccaaagatggagtgagggaggtttttgaaatggctacgagagctgctctgcaagcc agacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system