Otolemur garnettii (small-eared galago): 100955778 Help Entry 100955778         CDS       T07855                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04060   Cytokine-cytokine receptor interaction oga04061   Viral protein interaction with cytokine and cytokine receptor oga04062   Chemokine signaling pathway oga04620   Toll-like receptor signaling pathway oga05142   Chagas disease oga05163   Human cytomegalovirus infection oga05323   Rheumatoid arthritis oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100955778    04061 Viral protein interaction with cytokine and cytokine receptor     100955778  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100955778    04062 Chemokine signaling pathway     100955778  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100955778   09174 Infectious disease: parasitic    05142 Chagas disease     100955778   09163 Immune disease    05323 Rheumatoid arthritis     100955778   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100955778  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100955778    00536 Glycosaminoglycan binding proteins [BR:oga00536]     100955778 Cytokines and neuropeptides [BR:oga04052]  Cytokines   Chemokines    100955778 Glycosaminoglycan binding proteins [BR:oga00536]  Heparan sulfate / Heparin   Chemokines    100955778 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100955778 NCBI-ProteinID:  XP_003795673 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MEVPIAALAVLFFTEALCPQAWSASFGANTPTACFFSYISQQIPLKFVDDYHESSSQCSK PAVIFLTKRGRLVCADPSEAWVQEHVTNLEPNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtgcctattgctgcccttgctgtcctgttcttcacagaggccctctgcccccag gcctggtctgcctcatttggtgctaacaccccaacagcctgcttcttctcctatatctcc cagcagattccgctcaaatttgtggatgactatcatgagagcagcagccagtgctccaag ccggctgtcatcttcctaaccaagagaggccggctggtctgtgctgaccccagtgaggcc tgggtccaggagcacgtcaccaatctggagccaaatgcctga

DBGET integrated database retrieval system