Otolemur garnettii (small-eared galago): 100956411 Help Entry 100956411         CDS       T07855                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga03410   Base excision repair oga04140   Autophagy - animal oga04217   Necroptosis oga04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     100956411 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100956411 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100956411 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100956411 (HMGB1)    03400 DNA repair and recombination proteins [BR:oga03400]     100956411 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100956411 (HMGB1) Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     100956411 (HMGB1) DNA repair and recombination proteins [BR:oga03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      100956411 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      100956411 (HMGB1) Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100956411 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 NOA36 Motif Other DBs NCBI-GeneID:  100956411 NCBI-ProteinID:  XP_012665454 Ensembl:  ENSOGAG00000003205 UniProt:  H0WMA9 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEE NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgtcgggaggagcacaagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagatatggcaaaggcggacaaggcccgttacgaaagagaaatgaaaacctatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttctgttctgagtatcgccccaaaatcaaaggagaacatcccggccta tccattggtgatgttgcaaagaagctgggagagatgtggaataacactgctgcagatgac aagcagccttatgaaaagaaggctgcaaagctgaaggaaaaatacgaaaaggatattgct gcataccgagctaaaggaaagcctgatgcagcgaaaaagggcgtcgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaagaggaggag gaagatgaagaagatgaagatgaagaagaa

DBGET integrated database retrieval system