Otolemur garnettii (small-eared galago): 100957213 Help Entry 100957213         CDS       T07855                                  Name (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism oga  Otolemur garnettii (small-eared galago) Pathway oga00480   Glutathione metabolism oga00980   Metabolism of xenobiotics by cytochrome P450 oga00982   Drug metabolism - cytochrome P450 oga00983   Drug metabolism - other enzymes oga01100   Metabolic pathways oga01524   Platinum drug resistance oga05200   Pathways in cancer oga05204   Chemical carcinogenesis - DNA adducts oga05207   Chemical carcinogenesis - receptor activation oga05208   Chemical carcinogenesis - reactive oxygen species oga05225   Hepatocellular carcinoma oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100957213   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100957213    00982 Drug metabolism - cytochrome P450     100957213    00983 Drug metabolism - other enzymes     100957213  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100957213    05204 Chemical carcinogenesis - DNA adducts     100957213    05207 Chemical carcinogenesis - receptor activation     100957213    05208 Chemical carcinogenesis - reactive oxygen species     100957213   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100957213   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100957213   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100957213  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:oga02000]     100957213 Enzymes [BR:oga01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100957213 Transporters [BR:oga02000]  Other transporters   Pores ion channels [TC:1]    100957213 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_N GST_C GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  100957213 NCBI-ProteinID:  XP_003789694 Ensembl:  ENSOGAG00000007865 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MAEKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQEGNHLLFQQVPMVEI DGMKLVQTRSILHYIAAKHNLFGKDLKERTLIDMYVEGTLDLLEMIIMHPFLKPDDQQKE VVGMAQKAIIRYFPVFEKILRGHGQTFLVGNQLSLADIILLQTILALEEKIPNILASFPF LQEYTVKISNIPTIKRFLEPGSKKKPPPDDIYVRTVYNVFMP NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcagagaagcccaagctccactatcccaacggaagaggccggatggaatccgtaaga tgggttttagctgcggctggagtcgagtttgatgaagaatttctggaaaccaaagaacag ttgcaaaagttgcaggagggtaaccacctgctcttccagcaagtgcccatggttgaaatc gacgggatgaagctggtgcagacccgaagcatcctccactacatagctgcaaagcacaat ctcttcggcaaagacctcaaggagagaaccctgattgacatgtatgtggaagggaccctg gatctgctggagatgattatcatgcatcctttcttaaagccagacgatcagcaaaaggaa gtggttggcatggcgcagaaggctataattaggtactttcccgtgtttgaaaagatttta aggggtcacggacaaacctttcttgttggtaatcagctgagccttgcggacataattctt ctccaaaccattttggctctagaagagaaaattcctaatatcttggcttcatttcctttc ctccaggagtacacagtgaaaataagtaatatccctacgattaagagattccttgaacca ggcagcaagaagaagccacctcctgatgacatctatgtgagaacagtctacaatgtcttt atgccgtga

DBGET integrated database retrieval system