KEGG   Otolemur garnettii (small-eared galago): 100957343
Entry
100957343         CDS       T07855                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
oga  Otolemur garnettii (small-eared galago)
Pathway
oga01521  EGFR tyrosine kinase inhibitor resistance
oga01522  Endocrine resistance
oga01524  Platinum drug resistance
oga04010  MAPK signaling pathway
oga04012  ErbB signaling pathway
oga04014  Ras signaling pathway
oga04015  Rap1 signaling pathway
oga04022  cGMP-PKG signaling pathway
oga04024  cAMP signaling pathway
oga04062  Chemokine signaling pathway
oga04066  HIF-1 signaling pathway
oga04068  FoxO signaling pathway
oga04071  Sphingolipid signaling pathway
oga04072  Phospholipase D signaling pathway
oga04114  Oocyte meiosis
oga04140  Autophagy - animal
oga04148  Efferocytosis
oga04150  mTOR signaling pathway
oga04151  PI3K-Akt signaling pathway
oga04210  Apoptosis
oga04218  Cellular senescence
oga04261  Adrenergic signaling in cardiomyocytes
oga04270  Vascular smooth muscle contraction
oga04350  TGF-beta signaling pathway
oga04360  Axon guidance
oga04370  VEGF signaling pathway
oga04371  Apelin signaling pathway
oga04380  Osteoclast differentiation
oga04510  Focal adhesion
oga04517  IgSF CAM signaling
oga04520  Adherens junction
oga04540  Gap junction
oga04550  Signaling pathways regulating pluripotency of stem cells
oga04611  Platelet activation
oga04613  Neutrophil extracellular trap formation
oga04620  Toll-like receptor signaling pathway
oga04621  NOD-like receptor signaling pathway
oga04625  C-type lectin receptor signaling pathway
oga04650  Natural killer cell mediated cytotoxicity
oga04657  IL-17 signaling pathway
oga04658  Th1 and Th2 cell differentiation
oga04659  Th17 cell differentiation
oga04660  T cell receptor signaling pathway
oga04662  B cell receptor signaling pathway
oga04664  Fc epsilon RI signaling pathway
oga04666  Fc gamma R-mediated phagocytosis
oga04668  TNF signaling pathway
oga04713  Circadian entrainment
oga04720  Long-term potentiation
oga04722  Neurotrophin signaling pathway
oga04723  Retrograde endocannabinoid signaling
oga04724  Glutamatergic synapse
oga04725  Cholinergic synapse
oga04726  Serotonergic synapse
oga04730  Long-term depression
oga04810  Regulation of actin cytoskeleton
oga04910  Insulin signaling pathway
oga04912  GnRH signaling pathway
oga04914  Progesterone-mediated oocyte maturation
oga04915  Estrogen signaling pathway
oga04916  Melanogenesis
oga04917  Prolactin signaling pathway
oga04919  Thyroid hormone signaling pathway
oga04921  Oxytocin signaling pathway
oga04926  Relaxin signaling pathway
oga04928  Parathyroid hormone synthesis, secretion and action
oga04929  GnRH secretion
oga04930  Type II diabetes mellitus
oga04933  AGE-RAGE signaling pathway in diabetic complications
oga04934  Cushing syndrome
oga04935  Growth hormone synthesis, secretion and action
oga04960  Aldosterone-regulated sodium reabsorption
oga05010  Alzheimer disease
oga05020  Prion disease
oga05022  Pathways of neurodegeneration - multiple diseases
oga05034  Alcoholism
oga05132  Salmonella infection
oga05133  Pertussis
oga05135  Yersinia infection
oga05140  Leishmaniasis
oga05142  Chagas disease
oga05145  Toxoplasmosis
oga05152  Tuberculosis
oga05160  Hepatitis C
oga05161  Hepatitis B
oga05163  Human cytomegalovirus infection
oga05164  Influenza A
oga05165  Human papillomavirus infection
oga05166  Human T-cell leukemia virus 1 infection
oga05167  Kaposi sarcoma-associated herpesvirus infection
oga05170  Human immunodeficiency virus 1 infection
oga05171  Coronavirus disease - COVID-19
oga05200  Pathways in cancer
oga05203  Viral carcinogenesis
oga05205  Proteoglycans in cancer
oga05206  MicroRNAs in cancer
oga05207  Chemical carcinogenesis - receptor activation
oga05208  Chemical carcinogenesis - reactive oxygen species
oga05210  Colorectal cancer
oga05211  Renal cell carcinoma
oga05212  Pancreatic cancer
oga05213  Endometrial cancer
oga05214  Glioma
oga05215  Prostate cancer
oga05216  Thyroid cancer
oga05218  Melanoma
oga05219  Bladder cancer
oga05220  Chronic myeloid leukemia
oga05221  Acute myeloid leukemia
oga05223  Non-small cell lung cancer
oga05224  Breast cancer
oga05225  Hepatocellular carcinoma
oga05226  Gastric cancer
oga05230  Central carbon metabolism in cancer
oga05231  Choline metabolism in cancer
oga05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oga05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100957343 (MAPK3)
   04012 ErbB signaling pathway
    100957343 (MAPK3)
   04014 Ras signaling pathway
    100957343 (MAPK3)
   04015 Rap1 signaling pathway
    100957343 (MAPK3)
   04350 TGF-beta signaling pathway
    100957343 (MAPK3)
   04370 VEGF signaling pathway
    100957343 (MAPK3)
   04371 Apelin signaling pathway
    100957343 (MAPK3)
   04668 TNF signaling pathway
    100957343 (MAPK3)
   04066 HIF-1 signaling pathway
    100957343 (MAPK3)
   04068 FoxO signaling pathway
    100957343 (MAPK3)
   04072 Phospholipase D signaling pathway
    100957343 (MAPK3)
   04071 Sphingolipid signaling pathway
    100957343 (MAPK3)
   04024 cAMP signaling pathway
    100957343 (MAPK3)
   04022 cGMP-PKG signaling pathway
    100957343 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100957343 (MAPK3)
   04150 mTOR signaling pathway
    100957343 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    100957343 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100957343 (MAPK3)
   04148 Efferocytosis
    100957343 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100957343 (MAPK3)
   04210 Apoptosis
    100957343 (MAPK3)
   04218 Cellular senescence
    100957343 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100957343 (MAPK3)
   04520 Adherens junction
    100957343 (MAPK3)
   04540 Gap junction
    100957343 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100957343 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100957343 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100957343 (MAPK3)
   04613 Neutrophil extracellular trap formation
    100957343 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100957343 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100957343 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    100957343 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100957343 (MAPK3)
   04660 T cell receptor signaling pathway
    100957343 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    100957343 (MAPK3)
   04659 Th17 cell differentiation
    100957343 (MAPK3)
   04657 IL-17 signaling pathway
    100957343 (MAPK3)
   04662 B cell receptor signaling pathway
    100957343 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100957343 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100957343 (MAPK3)
   04062 Chemokine signaling pathway
    100957343 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100957343 (MAPK3)
   04929 GnRH secretion
    100957343 (MAPK3)
   04912 GnRH signaling pathway
    100957343 (MAPK3)
   04915 Estrogen signaling pathway
    100957343 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100957343 (MAPK3)
   04917 Prolactin signaling pathway
    100957343 (MAPK3)
   04921 Oxytocin signaling pathway
    100957343 (MAPK3)
   04926 Relaxin signaling pathway
    100957343 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    100957343 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100957343 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    100957343 (MAPK3)
   04916 Melanogenesis
    100957343 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100957343 (MAPK3)
   04270 Vascular smooth muscle contraction
    100957343 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100957343 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100957343 (MAPK3)
   04725 Cholinergic synapse
    100957343 (MAPK3)
   04726 Serotonergic synapse
    100957343 (MAPK3)
   04720 Long-term potentiation
    100957343 (MAPK3)
   04730 Long-term depression
    100957343 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100957343 (MAPK3)
   04722 Neurotrophin signaling pathway
    100957343 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    100957343 (MAPK3)
   04380 Osteoclast differentiation
    100957343 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100957343 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100957343 (MAPK3)
   05206 MicroRNAs in cancer
    100957343 (MAPK3)
   05205 Proteoglycans in cancer
    100957343 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    100957343 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100957343 (MAPK3)
   05203 Viral carcinogenesis
    100957343 (MAPK3)
   05230 Central carbon metabolism in cancer
    100957343 (MAPK3)
   05231 Choline metabolism in cancer
    100957343 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100957343 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100957343 (MAPK3)
   05212 Pancreatic cancer
    100957343 (MAPK3)
   05225 Hepatocellular carcinoma
    100957343 (MAPK3)
   05226 Gastric cancer
    100957343 (MAPK3)
   05214 Glioma
    100957343 (MAPK3)
   05216 Thyroid cancer
    100957343 (MAPK3)
   05221 Acute myeloid leukemia
    100957343 (MAPK3)
   05220 Chronic myeloid leukemia
    100957343 (MAPK3)
   05218 Melanoma
    100957343 (MAPK3)
   05211 Renal cell carcinoma
    100957343 (MAPK3)
   05219 Bladder cancer
    100957343 (MAPK3)
   05215 Prostate cancer
    100957343 (MAPK3)
   05213 Endometrial cancer
    100957343 (MAPK3)
   05224 Breast cancer
    100957343 (MAPK3)
   05223 Non-small cell lung cancer
    100957343 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100957343 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    100957343 (MAPK3)
   05161 Hepatitis B
    100957343 (MAPK3)
   05160 Hepatitis C
    100957343 (MAPK3)
   05171 Coronavirus disease - COVID-19
    100957343 (MAPK3)
   05164 Influenza A
    100957343 (MAPK3)
   05163 Human cytomegalovirus infection
    100957343 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100957343 (MAPK3)
   05165 Human papillomavirus infection
    100957343 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100957343 (MAPK3)
   05135 Yersinia infection
    100957343 (MAPK3)
   05133 Pertussis
    100957343 (MAPK3)
   05152 Tuberculosis
    100957343 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100957343 (MAPK3)
   05140 Leishmaniasis
    100957343 (MAPK3)
   05142 Chagas disease
    100957343 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100957343 (MAPK3)
   05020 Prion disease
    100957343 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100957343 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    100957343 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100957343 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100957343 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100957343 (MAPK3)
   04934 Cushing syndrome
    100957343 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100957343 (MAPK3)
   01524 Platinum drug resistance
    100957343 (MAPK3)
   01522 Endocrine resistance
    100957343 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oga01001]
    100957343 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oga03036]
    100957343 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oga04147]
    100957343 (MAPK3)
Enzymes [BR:oga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100957343 (MAPK3)
Protein kinases [BR:oga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100957343 (MAPK3)
Chromosome and associated proteins [BR:oga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100957343 (MAPK3)
Exosome [BR:oga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100957343 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 100957343
NCBI-ProteinID: XP_003795827
Ensembl: ENSOGAG00000027841
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPRGADGVGLGVSGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCVINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGGLEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccggggagccgatggggtc
ggcctgggggtctcgggggaagtagagatggtgaaggggcagccgttcgacgtgggaccg
cgctacacgcagctgcaatacattggcgagggcgcctatggcatggtcagctcagcttat
gaccatgtgcgcaagactcgagtagccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctacgggagatacagatcttacttcgattccgtcatgagaatgtc
attggcatcagagacattctgcgggcacccaccctggaagctatgagagatgtctacatt
gtgcaggacctgatggagacagacctatacaagttactcaaaagccagcagctgagcaac
gatcacatctgctacttcctctaccagatcctgcggggcctcaagtatatccactcagcc
aatgtgctccaccgagatctaaagccctctaacctgctcatcaacaccacctgtgacctt
aagatctgcgatttcggcctggcccggattgctgatcctgagcatgaccacactggcttt
ctgactgagtatgtggctacacgctggtaccgagccccagagatcatgctgaactccaag
ggctacaccaagtccatcgatatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagcttaaccacattctgggcatt
ctgggctccccatcccaagaggacctaaattgtgtcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcctgggccaaactttttcccaagtcagac
tccaaagcccttgacctgctggaccggatgttaactttcaaccccaacaaacggatcaca
gtggaggaagcactggctcacccctacctagagcagtactacgatccaacagatgagcca
gtggctgaggagcccttcacctttgatatggagctggatgatctacccaaggagcggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggggctggaggccccataa

DBGET integrated database retrieval system