Otolemur garnettii (small-eared galago): 100958250 Help Entry 100958250         CDS       T07855                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04081   Hormone signaling oga04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     100958250 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     100958250 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100958250 (GAST) Cytokines and neuropeptides [BR:oga04052]  Neuropeptides   GPCR binding    100958250 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  100958250 NCBI-ProteinID:  XP_003786711 Ensembl:  ENSOGAG00000009512 UniProt:  H0X0Q6 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MQRLCMYALISALALATFSEASWKPHSQLPGVPSGPVANRDLEQQQHWLDQMKAASHHRR QLGPQGPPHLVADLSKKQGPWMEEEEEAYGWMDFGRRSAEEGNEHP NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgcatgtatgcactgatctctgcactggctctggccaccttctccgaa gcttcttggaagccccactcccagctgccaggtgtgccgtcaggtccagtggccaacaga gacctggagcagcagcagcactggctggaccagatgaaggcagcctctcaccaccgaagg cagctggggccccagggccccccacaccttgtggcagatctgtccaagaagcaggggcca tggatggaggaagaagaggaagcttatggatggatggacttcggccgtcgcagtgctgag gaagggaacgaacatccctaa

DBGET integrated database retrieval system