Otolemur garnettii (small-eared galago): 100958585 Help Entry 100958585         CDS       T07855                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04010   MAPK signaling pathway oga04014   Ras signaling pathway oga04015   Rap1 signaling pathway oga04020   Calcium signaling pathway oga04151   PI3K-Akt signaling pathway oga04810   Regulation of actin cytoskeleton oga05200   Pathways in cancer oga05207   Chemical carcinogenesis - receptor activation oga05218   Melanoma oga05224   Breast cancer oga05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100958585 (FGF22)    04014 Ras signaling pathway     100958585 (FGF22)    04015 Rap1 signaling pathway     100958585 (FGF22)    04020 Calcium signaling pathway     100958585 (FGF22)    04151 PI3K-Akt signaling pathway     100958585 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100958585 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100958585 (FGF22)    05207 Chemical carcinogenesis - receptor activation     100958585 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     100958585 (FGF22)    05218 Melanoma     100958585 (FGF22)    05224 Breast cancer     100958585 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100958585 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:oga00536]     100958585 (FGF22) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Growth factors (RTK binding)    100958585 (FGF22) Glycosaminoglycan binding proteins [BR:oga00536]  Heparan sulfate / Heparin   Growth factors/receptors    100958585 (FGF22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF DUF6531 Motif Other DBs NCBI-GeneID:  100958585 NCBI-ProteinID:  XP_003788722 Ensembl:  ENSOGAG00000007914 UniProt:  H0WXB8 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MRRRLWLGLVWLLLAQEPDAPTALRRVRNYPHLEGDVRWRRLFSSTHFFLRVDPTGRVQG TRWRHSLESVVEIRSVRVGVVVIKAAYSGFYVAMNRRGRLYGSRVYTVDCRFQERIEENG YNTYAALRWRHHGQPMFLALDRRGAPRPGGRTQRHHLSTHFLPVLVS NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgcgccgccgcctgtggctgggcttggtctggctgctgctggcgcaggagcctgacgcc ccaactgcattgcggagagtgcgcaactacccgcacctggagggcgacgtgcgctggcgg cgcctcttctcctctacccactttttcctgcgtgtggatcccactggccgtgtgcagggt acccgctggcgccacagcctggagagcgtggttgagatccgttctgtccgcgtgggcgtc gttgtcatcaaggctgcgtactcaggcttctatgtggccatgaaccgcaggggccgcctc tatgggtcgcgggtctacactgttgactgcaggttccaggagcgcatcgaggagaatggc tacaacacctatgcagcactgcgctggcgccaccatggccagcctatgttcctggcacta gacaggaggggggctccccggcctggtggccggacacagcggcaccacctatctacccac ttcctgcctgtcctggtctcctga

DBGET integrated database retrieval system