Otolemur garnettii (small-eared galago): 100958945 Help Entry 100958945         CDS       T07855                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04010   MAPK signaling pathway oga04014   Ras signaling pathway oga04024   cAMP signaling pathway oga04072   Phospholipase D signaling pathway oga04137   Mitophagy - animal oga04140   Autophagy - animal oga04218   Cellular senescence oga04371   Apelin signaling pathway oga04625   C-type lectin receptor signaling pathway oga04810   Regulation of actin cytoskeleton oga05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100958945 (RRAS2)    04014 Ras signaling pathway     100958945 (RRAS2)    04371 Apelin signaling pathway     100958945 (RRAS2)    04072 Phospholipase D signaling pathway     100958945 (RRAS2)    04024 cAMP signaling pathway     100958945 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100958945 (RRAS2)    04137 Mitophagy - animal     100958945 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     100958945 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100958945 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100958945 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100958945 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100958945 (RRAS2)    04031 GTP-binding proteins [BR:oga04031]     100958945 (RRAS2) Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100958945 (RRAS2)   Exosomal proteins of bladder cancer cells    100958945 (RRAS2) GTP-binding proteins [BR:oga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100958945 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Arf Roc NPHI_C FeThRed_B Motif Other DBs NCBI-GeneID:  100958945 NCBI-ProteinID:  XP_023372776 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQV TQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKK GCHCVIF NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgagagaacagtatatgaggactggtgagggtttcctgttggtcttttcagtcacagat agaggcagttttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgt gatgagtttccaatgattttaattggtaataaagccgacctggatcatcaaagacaggta acacaggaagaaggacagcaattagctcgacaacttaaggtaacatatatggaggcatca gcaaagattaggatgaatgtagatcaagctttccatgaacttgtccgggttataaggaaa tttcaagagcaggaatgtcctccttcaccggaaccaacgcggaaagaaaaagacaagaaa ggctgccattgtgtcattttctag

DBGET integrated database retrieval system