Otolemur garnettii (small-eared galago): 100959151 Help Entry 100959151         CDS       T07855                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04613   Neutrophil extracellular trap formation oga05034   Alcoholism oga05202   Transcriptional misregulation in cancer oga05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oga00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100959151  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100959151   09163 Immune disease    05322 Systemic lupus erythematosus     100959151   09165 Substance dependence    05034 Alcoholism     100959151  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100959151   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100959151 Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100959151 Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100959151 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF THSD1_D2 Motif Other DBs NCBI-GeneID:  100959151 NCBI-ProteinID:  XP_012665079 Ensembl:  ENSOGAG00000029059 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTAGKSSSGKAPRKQRATKAARKSAPSTGGVKKPHRCRPGTVALREIRRYQKSPE LLIRKLPFQRPVGEIAQDFKTDLRFQSAAIGALQEASEAYQVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGVRA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgccggcaaatccagcagtggtaaagcacccaggaagcag cgggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgctgcaggcctggtactgtggcactccgtgaaataagacgttatcagaagtctcctgaa cttctgattcgcaaacttcctttccagcgtccggtgggagaaattgctcaggactttaag acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat caggttggcctttttgaagacaccaacctgtgtgctattcatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagtacgtgcttaa

DBGET integrated database retrieval system