Otolemur garnettii (small-eared galago): 100960556 Help Entry 100960556         CDS       T07855                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04015   Rap1 signaling pathway oga04810   Regulation of actin cytoskeleton oga05014   Amyotrophic lateral sclerosis oga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100960556 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100960556 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100960556 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100960556 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100960556 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oga04812]     100960556 (PFN3)    04147 Exosome [BR:oga04147]     100960556 (PFN3) Membrane trafficking [BR:oga04131]  Others   Actin-binding proteins    Others     100960556 (PFN3) Cytoskeleton proteins [BR:oga04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100960556 (PFN3) Exosome [BR:oga04147]  Exosomal proteins   Proteins found in most exosomes    100960556 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100960556 NCBI-ProteinID:  XP_003802881 Ensembl:  ENSOGAG00000000752 UniProt:  H0WH43 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHADNRCVWASRPGGLLAAISPQEVGVLTGTDRRTFL QSGLSVAGRRCCIIRDYLLADGDGVLDARTKGLDGRAVCVGHSPRALLVLMGRRGVHGGI LNKTVHELIRGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggctacattagtgcggtgctgagggatcagcgcatcgacgacgtg gctatcgtgggccacgcagacaatcgctgcgtgtgggcatcacggcccgggggcctactg gcggccatctcaccgcaggaggtgggcgtgctcactgggacagaccggcgcaccttcctg cagtcgggcctgagcgtggcgggccgccggtgctgcatcatccgtgactacctgctggcg gacggcgacggcgtgctggacgcgcgcaccaaggggctggatgggcgggccgtatgcgtg ggccactcgccacgtgcgctccttgtgctcatgggccgacgcggcgtgcacgggggcatc ctcaataagaccgtgcacgagctgatccgcgggcttcgcacacagggcacctag

DBGET integrated database retrieval system