Otolemur garnettii (small-eared galago): 100960940 Help Entry 100960940         CDS       T07855                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04360   Axon guidance oga04666   Fc gamma R-mediated phagocytosis oga04810   Regulation of actin cytoskeleton oga05133   Pertussis oga05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:oga00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100960940 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100960940 (CFL1)   09158 Development and regeneration    04360 Axon guidance     100960940 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100960940 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     100960940 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100960940 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oga04812]     100960940 (CFL1)    04147 Exosome [BR:oga04147]     100960940 (CFL1) Membrane trafficking [BR:oga04131]  Others   Actin-binding proteins    Others     100960940 (CFL1) Cytoskeleton proteins [BR:oga04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      100960940 (CFL1) Exosome [BR:oga04147]  Exosomal proteins   Proteins found in most exosomes    100960940 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  100960940 NCBI-ProteinID:  XP_003798723 Ensembl:  ENSOGAG00000016503 UniProt:  H0XFH7 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggcgtcattaaggtgttcaatgacatgaaggtg cgcaagtcttcaacgccagaggaggtgaagaagcgcaagaaggcagtgctcttctgcctg agtgaggacaagaagaacatcatcctagaggagggcaaggagatcctggtaggtgatgtg ggccagactgtcgatgatccctacgccacctttgtcaagatgcttccagacaaggactgc cgctatgccctctacgatgcaacctatgagaccaaggagagcaagaaggaggacctagtg tttatcttttgggctcctgagtgtgcaccccttaagagcaaaatgatttatgccagctcc aaggacgccatcaagaagaagctgacagggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagtgctgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system