Otolemur garnettii (small-eared galago): 100961857 Help Entry 100961857         CDS       T07855                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04015   Rap1 signaling pathway oga04810   Regulation of actin cytoskeleton oga05014   Amyotrophic lateral sclerosis oga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100961857 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100961857 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100961857 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100961857 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100961857 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oga04812]     100961857 (PFN1)    04147 Exosome [BR:oga04147]     100961857 (PFN1) Membrane trafficking [BR:oga04131]  Others   Actin-binding proteins    Others     100961857 (PFN1) Cytoskeleton proteins [BR:oga04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100961857 (PFN1) Exosome [BR:oga04147]  Exosomal proteins   Proteins found in most exosomes    100961857 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100961857 NCBI-ProteinID:  XP_003791269 Ensembl:  ENSOGAG00000031395 UniProt:  H0XTR7 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgca gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccctggaaaaaccttc gtcaacatcacgccagctgaggttggtgttcttgttggcaaagaccggtcaagttttttt gtgaatgggctgacacttgggggccagaaatgttctgtgatccgagactcgctgctgcag gatggggaatttaccatggatcttcgtaccaagagcaccggtggagctcccactttcaat gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccat ggtggtttgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system