Otolemur garnettii (small-eared galago): 100963702 Help Entry 100963702         CDS       T07855                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04382   Cornified envelope formation oga05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oga00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     100963702  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100963702  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100963702 Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of microglial cells    100963702 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EFhand_Ca_insen EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  100963702 NCBI-ProteinID:  XP_012668705 Ensembl:  ENSOGAG00000029993 UniProt:  H0XFB9 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLALDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcagatggagcacgccatggaaaccatgatgttcacatttcacaaatttgcc ggggataaaggctacttaacaaaggaggacctcagagtgctcatggagaaggagttccca ggatttttggaaaatcaaaaagaccctctggccttagacaaaataatgaaggacctggac cagtgccgagatggcaaagtgggcttccagagcttcttttccctaattgcgggcctcacc atcgcgtgcaacgactacttcgtagtacacatgaagcagaagggcaagaagtag

DBGET integrated database retrieval system