Otolemur garnettii (small-eared galago): 100963851 Help Entry 100963851         CDS       T07855                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga03272   Virion - Hepatitis viruses oga04382   Cornified envelope formation oga04514   Cell adhesion molecule (CAM) interaction oga04530   Tight junction oga04670   Leukocyte transendothelial migration oga05160   Hepatitis C Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     100963851 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     100963851 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     100963851 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100963851 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     100963851 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     100963851 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oga03037]     100963851 (CLDN4)    04147 Exosome [BR:oga04147]     100963851 (CLDN4) Cilium and associated proteins [BR:oga03037]  Other cilia and associated proteins   Stereociliary proteins    100963851 (CLDN4) Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    100963851 (CLDN4)   Exosomal proteins of colorectal cancer cells    100963851 (CLDN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 L_HMGIC_fpl TMEM37 Clc-like DUF7541 DUF4131 Motif Other DBs NCBI-GeneID:  100963851 NCBI-ProteinID:  XP_012663352 Ensembl:  ENSOGAG00000010344 LinkDB All DBs Position Unknown AA seq 195 aa AA seqDB search VLGWLGAMLSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALP QDLQAARALIVICIIVAALGVLLSIVGGKCTNCVEDESAKAKTMIVAGVVFLLAGLLVMV PVSWTAHNIIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGALLCCNCPPRTDKPYS AKYSAARSAAASNYV NT seq 588 nt NT seq  +upstreamnt  +downstreamnt gtgctgggctggctgggcgccatgctgagctgtgcgctgcccatgtggcgcgtgacggct ttcatcggcagcaacatcgtcacgtcgcagaccatctgggagggcctgtggatgaactgt gtggtgcagagtaccggccagatgcagtgcaaggtgtacgactcgctgctggcactgcca caagacctgcaggcagctcgcgccctcatcgtcatctgcattattgtggccgcattgggc gtgctgctgtccattgtggggggcaagtgcaccaactgcgtggaggatgaaagcgctaag gccaagaccatgattgtggctggtgtggtattcctgctggctggcttgctggtgatggtt cctgtgtcttggacggcccacaacatcatccgtgacttctacaacccactggtggcctct ggacagaagcgggagatgggtgcatcactgtacatcggctgggccgcctcaggcctgctg ctgctcgggggagccttgctctgctgcaactgcccacctcgtaccgacaagccctactca gccaagtattctgccgcccggtccgcagcagccagcaactatgtgtaa

DBGET integrated database retrieval system