Otolemur garnettii (small-eared galago): 100965098 Help Entry 100965098         CDS       T07855                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01522   Endocrine resistance oga04010   MAPK signaling pathway oga04012   ErbB signaling pathway oga04024   cAMP signaling pathway oga04137   Mitophagy - animal oga04210   Apoptosis oga04310   Wnt signaling pathway oga04380   Osteoclast differentiation oga04510   Focal adhesion oga04530   Tight junction oga04620   Toll-like receptor signaling pathway oga04621   NOD-like receptor signaling pathway oga04625   C-type lectin receptor signaling pathway oga04657   IL-17 signaling pathway oga04658   Th1 and Th2 cell differentiation oga04659   Th17 cell differentiation oga04660   T cell receptor signaling pathway oga04662   B cell receptor signaling pathway oga04668   TNF signaling pathway oga04722   Neurotrophin signaling pathway oga04912   GnRH signaling pathway oga04915   Estrogen signaling pathway oga04921   Oxytocin signaling pathway oga04926   Relaxin signaling pathway oga04932   Non-alcoholic fatty liver disease oga04933   AGE-RAGE signaling pathway in diabetic complications oga05030   Cocaine addiction oga05031   Amphetamine addiction oga05132   Salmonella infection oga05133   Pertussis oga05135   Yersinia infection oga05140   Leishmaniasis oga05142   Chagas disease oga05161   Hepatitis B oga05162   Measles oga05166   Human T-cell leukemia virus 1 infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05169   Epstein-Barr virus infection oga05170   Human immunodeficiency virus 1 infection oga05171   Coronavirus disease - COVID-19 oga05200   Pathways in cancer oga05203   Viral carcinogenesis oga05207   Chemical carcinogenesis - receptor activation oga05208   Chemical carcinogenesis - reactive oxygen species oga05210   Colorectal cancer oga05211   Renal cell carcinoma oga05224   Breast cancer oga05231   Choline metabolism in cancer oga05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oga05321   Inflammatory bowel disease oga05323   Rheumatoid arthritis oga05417   Lipid and atherosclerosis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100965098 (JUN)    04012 ErbB signaling pathway     100965098 (JUN)    04310 Wnt signaling pathway     100965098 (JUN)    04668 TNF signaling pathway     100965098 (JUN)    04024 cAMP signaling pathway     100965098 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100965098 (JUN)   09143 Cell growth and death    04210 Apoptosis     100965098 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100965098 (JUN)    04530 Tight junction     100965098 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100965098 (JUN)    04621 NOD-like receptor signaling pathway     100965098 (JUN)    04625 C-type lectin receptor signaling pathway     100965098 (JUN)    04660 T cell receptor signaling pathway     100965098 (JUN)    04658 Th1 and Th2 cell differentiation     100965098 (JUN)    04659 Th17 cell differentiation     100965098 (JUN)    04657 IL-17 signaling pathway     100965098 (JUN)    04662 B cell receptor signaling pathway     100965098 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     100965098 (JUN)    04915 Estrogen signaling pathway     100965098 (JUN)    04921 Oxytocin signaling pathway     100965098 (JUN)    04926 Relaxin signaling pathway     100965098 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     100965098 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     100965098 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100965098 (JUN)    05207 Chemical carcinogenesis - receptor activation     100965098 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     100965098 (JUN)    05203 Viral carcinogenesis     100965098 (JUN)    05231 Choline metabolism in cancer     100965098 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100965098 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     100965098 (JUN)    05211 Renal cell carcinoma     100965098 (JUN)    05224 Breast cancer     100965098 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100965098 (JUN)    05170 Human immunodeficiency virus 1 infection     100965098 (JUN)    05161 Hepatitis B     100965098 (JUN)    05171 Coronavirus disease - COVID-19     100965098 (JUN)    05162 Measles     100965098 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     100965098 (JUN)    05169 Epstein-Barr virus infection     100965098 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     100965098 (JUN)    05135 Yersinia infection     100965098 (JUN)    05133 Pertussis     100965098 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100965098 (JUN)    05142 Chagas disease     100965098 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     100965098 (JUN)    05321 Inflammatory bowel disease     100965098 (JUN)   09165 Substance dependence    05030 Cocaine addiction     100965098 (JUN)    05031 Amphetamine addiction     100965098 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100965098 (JUN)    05418 Fluid shear stress and atherosclerosis     100965098 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100965098 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     100965098 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100965098 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oga03000]     100965098 (JUN) Transcription factors [BR:oga03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     100965098 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha DUF3450 ATG16 TFIIA FlaC_arch Motif Other DBs NCBI-GeneID:  100965098 NCBI-ProteinID:  XP_003793174 Ensembl:  ENSOGAG00000005602 UniProt:  H0XMF1 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQAPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctgaacgcctcgttcctccag tccgagagcggcgcctatggctacagtaaccccaagatcctaaaacagagcatgaccctg aacttggccgatccggtgggcagcctgaagccgcacctccgcgccaagaactcggacctg ctcacctctcccgacgtggggcttctcaaactggcgtcacccgagctggagcgcctgata atccagtccagcaatgggcacatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacggacgagcaggagggctttgccgagggcttcgtgcgcgccctggccgaa ctgcatagccagaacactctgcccagcgtcacgtctgcggcgcagccggtcagcggggcg ggcatggtggctcccgcggtggcctcggtggccggaggcagcggcagtggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggactggcctttcccgcgcag ccccagcagcagcagcaggcgccgcagccgccgcaccacctgccccagcagatgcctgtg cagcacccgcggctgcaggcgctgaaggaggagccgcagacggtgcccgagatgcccggc gagacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctagagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgcttagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system