Otolemur garnettii (small-eared galago): 105886540 Help Entry 105886540         CDS       T07855                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04010   MAPK signaling pathway oga04020   Calcium signaling pathway oga04022   cGMP-PKG signaling pathway oga04114   Oocyte meiosis oga04218   Cellular senescence oga04310   Wnt signaling pathway oga04360   Axon guidance oga04370   VEGF signaling pathway oga04380   Osteoclast differentiation oga04625   C-type lectin receptor signaling pathway oga04650   Natural killer cell mediated cytotoxicity oga04658   Th1 and Th2 cell differentiation oga04659   Th17 cell differentiation oga04660   T cell receptor signaling pathway oga04662   B cell receptor signaling pathway oga04720   Long-term potentiation oga04724   Glutamatergic synapse oga04921   Oxytocin signaling pathway oga04922   Glucagon signaling pathway oga04924   Renin secretion oga05010   Alzheimer disease oga05014   Amyotrophic lateral sclerosis oga05020   Prion disease oga05022   Pathways of neurodegeneration - multiple diseases oga05031   Amphetamine addiction oga05152   Tuberculosis oga05163   Human cytomegalovirus infection oga05166   Human T-cell leukemia virus 1 infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05170   Human immunodeficiency virus 1 infection oga05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105886540 (PPP3R2)    04310 Wnt signaling pathway     105886540 (PPP3R2)    04370 VEGF signaling pathway     105886540 (PPP3R2)    04020 Calcium signaling pathway     105886540 (PPP3R2)    04022 cGMP-PKG signaling pathway     105886540 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105886540 (PPP3R2)    04218 Cellular senescence     105886540 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105886540 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     105886540 (PPP3R2)    04660 T cell receptor signaling pathway     105886540 (PPP3R2)    04658 Th1 and Th2 cell differentiation     105886540 (PPP3R2)    04659 Th17 cell differentiation     105886540 (PPP3R2)    04662 B cell receptor signaling pathway     105886540 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     105886540 (PPP3R2)    04921 Oxytocin signaling pathway     105886540 (PPP3R2)    04924 Renin secretion     105886540 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     105886540 (PPP3R2)    04720 Long-term potentiation     105886540 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     105886540 (PPP3R2)    04380 Osteoclast differentiation     105886540 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105886540 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105886540 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     105886540 (PPP3R2)    05163 Human cytomegalovirus infection     105886540 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     105886540 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     105886540 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     105886540 (PPP3R2)    05014 Amyotrophic lateral sclerosis     105886540 (PPP3R2)    05020 Prion disease     105886540 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     105886540 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     105886540 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105886540 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oga01009]     105886540 (PPP3R2) Protein phosphatases and associated proteins [BR:oga01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105886540 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  105886540 NCBI-ProteinID:  XP_012657750 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MGNEASYPKEIFPHFDSDEIKRLSKSFRKLDVDKSGSLSVEEFMSMPELQQNPLVRRVID VFDIDGNGEVDFHEFILGTSQFSLTGNEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNVKDWELQQLVDKTIITLDRDGDGKISFEEFSAVVRKMEIHKKLVLQVSHGRKRIQAF VLICFEKLVYQCIYDCLHSKCYQLSEAPHTAVRSQE NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgaggccagttacccgaaggagatattcccccactttgacagcgatgaaatt aaaaggctgagcaagagctttaggaagctggacgtggacaaatcgggctctctgagcgtg gaggagttcatgtccatgcccgagctgcagcagaacccgctggtgcggcgagtgatcgac gtctttgacattgacggcaacggagaagtggacttccacgaattcatcctggggacctcg cagttcagcctcacaggaaacgaggagcagaagctgcggttcgctttcagcatctacgac atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg ggaaacaacgtgaaggactgggagttacaacagctggtcgacaaaaccatcatcaccctg gacagggacggcgacgggaagatatcctttgaggaattcagcgcagtggtccgcaaaatg gagatccacaagaagctggtacttcaggttagccatggcaggaaaagaatacaagctttt gttttgatttgttttgaaaaattagtttaccagtgtatatatgactgcctgcactccaaa tgctaccagctctctgaagccccacatactgcagtcagatctcaagagtag

DBGET integrated database retrieval system