Otolemur garnettii (small-eared galago): 111725388 Help Entry 111725388         CDS       T07855                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04060   Cytokine-cytokine receptor interaction oga04061   Viral protein interaction with cytokine and cytokine receptor oga04062   Chemokine signaling pathway oga04064   NF-kappa B signaling pathway oga04072   Phospholipase D signaling pathway oga04218   Cellular senescence oga04620   Toll-like receptor signaling pathway oga04621   NOD-like receptor signaling pathway oga04622   RIG-I-like receptor signaling pathway oga04657   IL-17 signaling pathway oga04932   Non-alcoholic fatty liver disease oga04933   AGE-RAGE signaling pathway in diabetic complications oga04936   Alcoholic liver disease oga05132   Salmonella infection oga05133   Pertussis oga05134   Legionellosis oga05135   Yersinia infection oga05142   Chagas disease oga05144   Malaria oga05146   Amoebiasis oga05161   Hepatitis B oga05163   Human cytomegalovirus infection oga05164   Influenza A oga05167   Kaposi sarcoma-associated herpesvirus infection oga05171   Coronavirus disease - COVID-19 oga05200   Pathways in cancer oga05202   Transcriptional misregulation in cancer oga05219   Bladder cancer oga05323   Rheumatoid arthritis oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     111725388 (CXCL8)    04072 Phospholipase D signaling pathway     111725388 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111725388 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     111725388 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     111725388 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111725388 (CXCL8)    04621 NOD-like receptor signaling pathway     111725388 (CXCL8)    04622 RIG-I-like receptor signaling pathway     111725388 (CXCL8)    04657 IL-17 signaling pathway     111725388 (CXCL8)    04062 Chemokine signaling pathway     111725388 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111725388 (CXCL8)    05202 Transcriptional misregulation in cancer     111725388 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     111725388 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     111725388 (CXCL8)    05171 Coronavirus disease - COVID-19     111725388 (CXCL8)    05164 Influenza A     111725388 (CXCL8)    05163 Human cytomegalovirus infection     111725388 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     111725388 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     111725388 (CXCL8)    05135 Yersinia infection     111725388 (CXCL8)    05133 Pertussis     111725388 (CXCL8)    05134 Legionellosis     111725388 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     111725388 (CXCL8)    05144 Malaria     111725388 (CXCL8)    05142 Chagas disease     111725388 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     111725388 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111725388 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     111725388 (CXCL8)    04932 Non-alcoholic fatty liver disease     111725388 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     111725388 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     111725388 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:oga00536]     111725388 (CXCL8) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Chemokines    111725388 (CXCL8) Glycosaminoglycan binding proteins [BR:oga00536]  Heparan sulfate / Heparin   Chemokines    111725388 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  111725388 NCBI-ProteinID:  XP_023369181 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MTSRLAVAVLAAFLLSAALCDAAVLTRVGGELRCQCIKTHSASFHPKYIQELRVIESGPH CEKSEIM NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgacttccagactggccgtggctgtcctggcagccttcctgctgtctgcagcgctgtgt gatgctgcggttctcacaagggttggcggtgaactccgatgccagtgcataaagacgcac tctgcatccttccaccccaaatatatccaagagctgagagtgattgagagcgggccgcac tgtgagaagtcagagatcatgtaa

DBGET integrated database retrieval system