Oryza glaberrima (African rice): 127762433 Help Entry 127762433         CDS       T08853                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ogl  Oryza glaberrima (African rice) Pathway ogl04145   Phagosome ogl04148   Efferocytosis ogl04620   Toll-like receptor signaling pathway ogl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ogl00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127762433    04148 Efferocytosis     127762433  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127762433  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127762433  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogl04131]     127762433   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogl04147]     127762433    04031 GTP-binding proteins [BR:ogl04031]     127762433 Membrane trafficking [BR:ogl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127762433  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127762433   Macropinocytosis    Ras GTPases     127762433  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127762433 Exosome [BR:ogl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127762433   Exosomal proteins of other body fluids (saliva and urine)    127762433   Exosomal proteins of colorectal cancer cells    127762433   Exosomal proteins of bladder cancer cells    127762433 GTP-binding proteins [BR:ogl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127762433 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  127762433 NCBI-ProteinID:  XP_052142905 LinkDB All DBs Position 2:complement(982356..986061) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVLQP PKAKKKKKAQRGACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcataaagtgcgtcaccgtcggggacggcgccgtaggcaagacc tgcatgctcatctcctacacctccaacaccttccccactgattatgttccgacggtgttt gacaacttcagtgccaacgtcgtggttgatggtaacaccgtcaacctcgggctatgggac actgcaggtcaggaggattacaacagactgagaccactgagttatcgtggagctgatgtt ttccttctggccttctcgctaatcagcaaggccagctacgagaatgtttccaagaagtgg atacctgagctgaagcattatgcacctggtgtgcctatcatccttgtgggaacaaagctt gatcttcgagatgacaagcagttttttgtggaccatcctggtgctgttcctatcaccact gctcagggagaggaactaagaaagcaaataggcgccccatactacatcgaatgcagctca aagacccaactaaacgtcaagggcgtttttgatgcggcaataaaggtggtgctgcagcca cccaaggcgaagaagaagaaaaaggcgcaaaggggggcgtgctccattttgtga

DBGET integrated database retrieval system