Oryza glaberrima (African rice): 127772733 Help Entry 127772733         CDS       T08853                                  Name (RefSeq) calmodulin-2   KO K02183   calmodulin Organism ogl  Oryza glaberrima (African rice) Pathway ogl04016   MAPK signaling pathway - plant ogl04070   Phosphatidylinositol signaling system ogl04075   Plant hormone signal transduction ogl04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ogl00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     127772733    04070 Phosphatidylinositol signaling system     127772733    04075 Plant hormone signal transduction     127772733  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     127772733  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ogl01009]     127772733   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogl04131]     127772733    03036 Chromosome and associated proteins [BR:ogl03036]     127772733   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogl04147]     127772733 Protein phosphatases and associated proteins [BR:ogl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      127772733 Membrane trafficking [BR:ogl04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     127772733 Chromosome and associated proteins [BR:ogl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      127772733 Exosome [BR:ogl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    127772733 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin SPEF2_C FCaBP_EF-hand MotA_activ PA_Ig-like SurA_N_3 PhageMin_Tail DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  127772733 NCBI-ProteinID:  XP_052154654 LinkDB All DBs Position 5:complement(21206541..21208842) Genome browser AA seq 149 aa AA seqDB search MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaccagctcaccgacgagcagatcgccgagttcaaggaggcgttcagcctattc gacaaggacggcgacggttgcatcactactaaggagcttggaaccgtgatgcggtccctt ggtcagaacccaactgaggcggagctgcaggacatgatcaacgaggttgatgctgatggc aatgggaccattgacttcccagagttcctgaacctgatggcgaagaagatgaaggatacc gactctgaggaggagctcaaggaggccttccgtgtgtttgacaaggaccagaacggtttc atctcggctgctgagctccgccacgtcatgaccaaccttggtgagaagctgaccgacgag gaagttgacgagatgatccgtgaggctgacgtcgatggcgatggccagatcaactacgag gagttcgttaaggtcatgatggccaagtga

DBGET integrated database retrieval system