Oryza glaberrima (African rice): 127777716 Help Entry 127777716         CDS       T08853                                  Name (RefSeq) rac-like GTP-binding protein 4   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ogl  Oryza glaberrima (African rice) Pathway ogl04145   Phagosome ogl04148   Efferocytosis ogl04620   Toll-like receptor signaling pathway ogl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ogl00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127777716    04148 Efferocytosis     127777716  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127777716  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127777716  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogl04131]     127777716   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogl04147]     127777716    04031 GTP-binding proteins [BR:ogl04031]     127777716 Membrane trafficking [BR:ogl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127777716  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127777716   Macropinocytosis    Ras GTPases     127777716  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127777716 Exosome [BR:ogl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127777716   Exosomal proteins of other body fluids (saliva and urine)    127777716   Exosomal proteins of colorectal cancer cells    127777716   Exosomal proteins of bladder cancer cells    127777716 GTP-binding proteins [BR:ogl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127777716 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  127777716 NCBI-ProteinID:  XP_052160288 UniProt:  I1Q101 LinkDB All DBs Position 6:6934294..6938043 Genome browser AA seq 215 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVMKKWLPELQHYAPGVPIVLIGT KLDLREDKHYLLDHPSLVPVTTAQGEELRKHIGATCYIECSSKTQQNVKAVFDAAIKVVI KPPTKQRDRKKKKTRRGCSFFCKGVMSRRRLVCFK NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcgtcgcggttcatcaagtgcgtcacggtcggggacggcgccgtcggc aagacctgcatgctcatctgctacaccagcaacaagttccccactgattacgtacccact gtttttgacaatttcagtgcaaacgtggtggtcgacggcaccacggtgaatttgggtctc tgggatactgcagggcaggaagattacaacagattgaggccgctaagctaccgtggcgcc gatgtctttgtgcttgccttctccctagtgagccgagctagctatgagaatgtcatgaag aagtggttaccagagcttcagcattatgcaccaggggtgccaattgtgttgattgggacc aaattggatcttcgtgaagataaacactacttacttgaccatcctagcttggtgcctgtg actacagcacagggagaggaactccgcaagcacattggcgcaacgtgttacatcgaatgc agctcaaagacacagcagaatgtaaaagctgtgtttgatgctgccatcaaggtagtaatc aagcctccaacaaagcagagggacaggaagaagaagaaaacacggcggggatgttctttc ttctgcaagggtgtcatgtccagaagaaggctagtatgcttcaagtga

DBGET integrated database retrieval system