Oryza glaberrima (African rice): 127777846
Help
Entry
127777846 CDS
T08853
Name
(RefSeq) SKP1-like protein 5
KO
K03094
S-phase kinase-associated protein 1
Organism
ogl
Oryza glaberrima (African rice)
Pathway
ogl03083
Polycomb repressive complex
ogl04120
Ubiquitin mediated proteolysis
ogl04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
ogl00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
127777846
04120 Ubiquitin mediated proteolysis
127777846
09126 Chromosome
03083 Polycomb repressive complex
127777846
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ogl04131
]
127777846
04121 Ubiquitin system [BR:
ogl04121
]
127777846
03036 Chromosome and associated proteins [BR:
ogl03036
]
127777846
Membrane trafficking [BR:
ogl04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
127777846
Ubiquitin system [BR:
ogl04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
127777846
Cul7 complex
127777846
Chromosome and associated proteins [BR:
ogl03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
127777846
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
127777846
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
KIP1
Motif
Other DBs
NCBI-GeneID:
127777846
NCBI-ProteinID:
XP_052160427
LinkDB
All DBs
Position
6:complement(879589..880510)
Genome browser
AA seq
206 aa
AA seq
DB search
MSSWPLIGNQSPNVGRLRDRSASEFAVDQFRHLSARVTSSMAAAAEEKNKKMIKVISSDG
EAFEMTEAAASMSRILLHMIEDGCTGAGGAGITLPNVAGSALAKVIEYCTKHAIAAAEGS
SSSRKAKEELKKFDVEFMEVGIDMLYDLIMAANFMGVEGLLSLAAQRTAELIKGKSPEQI
REMFGIKNDHTPEEEEQIRKEYEWAF
NT seq
621 nt
NT seq
+upstream
nt +downstream
nt
atgagctcatggcccctgatcggcaatcaatcaccaaacgtgggtcgtctcagagatcga
tcagcttcagaattcgccgtcgatcaatttagacatctatcagctcgcgtgacatcatca
atggcggcggcggcagaagagaagaacaagaagatgatcaaggtgatcagctccgacggg
gaggccttcgagatgacggaggcggcggcgagcatgtcgcggatactcctccacatgatc
gaggacggctgcaccggcgccggcggcgccgggatcactctccccaacgtcgccggcagc
gccctcgccaaggtcatcgagtactgcaccaagcacgccatcgccgccgccgaaggtagc
agcagcagccgcaaggcgaaggaggagctgaagaagttcgacgtggagttcatggaggtg
ggcatcgacatgctgtacgacctgatcatggcggccaacttcatgggcgtggagggcctt
ctcagcctggcggcgcagcgcacggcggagctgatcaagggcaagtcgccggagcagatc
agggagatgttcgggatcaagaacgaccacacgccggaggaggaggagcagatccgcaag
gagtatgaatgggccttctag
DBGET
integrated database retrieval system