Oryza glaberrima (African rice): 127779719
Help
Entry
127779719 CDS
T08853
Name
(RefSeq) SKP1-like protein 11
KO
K03094
S-phase kinase-associated protein 1
Organism
ogl
Oryza glaberrima (African rice)
Pathway
ogl03083
Polycomb repressive complex
ogl04120
Ubiquitin mediated proteolysis
ogl04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
ogl00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
127779719
04120 Ubiquitin mediated proteolysis
127779719
09126 Chromosome
03083 Polycomb repressive complex
127779719
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ogl04131
]
127779719
04121 Ubiquitin system [BR:
ogl04121
]
127779719
03036 Chromosome and associated proteins [BR:
ogl03036
]
127779719
Membrane trafficking [BR:
ogl04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
127779719
Ubiquitin system [BR:
ogl04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
127779719
Cul7 complex
127779719
Chromosome and associated proteins [BR:
ogl03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
127779719
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
127779719
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
DUF7362
Motif
Other DBs
NCBI-GeneID:
127779719
NCBI-ProteinID:
XP_052162565
UniProt:
I1Q809
LinkDB
All DBs
Position
7:2458266..2458922
Genome browser
AA seq
171 aa
AA seq
DB search
MAAAAAEATIDGGGKMIILISADGKRFEVTEAVASQSQLISNMIEDDCTENGVRLPNVDG
DILTMVVDYCNMHAGDAAADGDTTKASSTEELKKFDAELVQALENPVLFKLILAANFLNI
KSLLDMTCQRVADMMSGKTPEQMRETFSIENDFTPEEEAAIRQENAWAFDD
NT seq
516 nt
NT seq
+upstream
nt +downstream
nt
atggcggcagcagcagcggaggccacgatcgatggcggcggcaagatgatcatcctgatc
agcgccgacgggaaacgcttcgaggtgacggaggcggtggcgagccaatcgcagctgata
tccaacatgatcgaggacgattgcacggagaacggggtgcgtctccccaacgtcgacggc
gacatcctcaccatggtcgtcgactactgcaacatgcacgccggcgacgccgccgccgac
ggcgacaccacgaaagcatcaagcacggaggagctgaagaagttcgacgccgagttggtg
caagccctcgagaatccggtgctgttcaagctgatcttggcggccaatttcttgaacatc
aagagcttgctggacatgacgtgccagcgcgtggcggacatgatgtccggcaagacgccg
gagcagatgagggagacgttttcgatcgagaacgacttcacgccggaggaggaggcggcg
attcgccaggagaacgcctgggccttcgacgactag
DBGET
integrated database retrieval system