Oryza glaberrima (African rice): 127779720 Help Entry 127779720         CDS       T08853                                  Name (RefSeq) SKP1-like protein 5   KO K03094   S-phase kinase-associated protein 1 Organism ogl  Oryza glaberrima (African rice) Pathway ogl03083   Polycomb repressive complex ogl04120   Ubiquitin mediated proteolysis ogl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ogl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127779720    04120 Ubiquitin mediated proteolysis     127779720   09126 Chromosome    03083 Polycomb repressive complex     127779720  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogl04131]     127779720    04121 Ubiquitin system [BR:ogl04121]     127779720    03036 Chromosome and associated proteins [BR:ogl03036]     127779720 Membrane trafficking [BR:ogl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     127779720 Ubiquitin system [BR:ogl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      127779720    Cul7 complex      127779720 Chromosome and associated proteins [BR:ogl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      127779720   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      127779720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ LZ3wCH Motif Other DBs NCBI-GeneID:  127779720 NCBI-ProteinID:  XP_052162567 UniProt:  I1Q808 LinkDB All DBs Position 7:complement(2457317..2457850) Genome browser AA seq 153 aa AA seqDB search MAADKKEVADDTILLISSDGEHFNVPVAAASLSQLVSNMIEDDCTTNGVPLPNVASKVIE YCGKHAAAAEDEEKELKSFDAEFMIDVDKNMLYGLLLASNFLNIKSLLDLCCQHTANLIK GKSPEQIRKEFGIKNDFTPEEEEIRKENTWAFE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcggcagacaagaaggaggttgccgacgacacgatcctcttaatcagctccgacggc gagcacttcaacgtgccggtggcggcggcgagcctgtcgcagctcgtctccaacatgatc gaggacgactgcacgacgaacggggtgcctctccccaacgtcgcctccaaggtcatcgaa tactgcggcaagcacgccgccgccgcggaggacgaggagaaggagctgaagagcttcgac gccgagttcatgatcgacgtggacaagaacatgctgtacggcttgctcctggcgtccaat ttcctgaacatcaagagcttgctggatttgtgctgccagcacacggcgaacctgatcaaa ggcaagtcgccggagcagatcaggaaggagtttgggatcaagaacgacttcacaccggag gaggaggaaatccgcaaggagaacacatgggcgttcgagtag

DBGET integrated database retrieval system