Oryza glaberrima (African rice): 127779937 Help Entry 127779937         CDS       T08853                                  Name (RefSeq) SKP1-like protein 5   KO K03094   S-phase kinase-associated protein 1 Organism ogl  Oryza glaberrima (African rice) Pathway ogl03083   Polycomb repressive complex ogl04120   Ubiquitin mediated proteolysis ogl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ogl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127779937    04120 Ubiquitin mediated proteolysis     127779937   09126 Chromosome    03083 Polycomb repressive complex     127779937  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogl04131]     127779937    04121 Ubiquitin system [BR:ogl04121]     127779937    03036 Chromosome and associated proteins [BR:ogl03036]     127779937 Membrane trafficking [BR:ogl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     127779937 Ubiquitin system [BR:ogl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      127779937    Cul7 complex      127779937 Chromosome and associated proteins [BR:ogl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      127779937   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      127779937 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB LZ3wCH Motif Other DBs NCBI-GeneID:  127779937 NCBI-ProteinID:  XP_052162831 UniProt:  I1Q811 LinkDB All DBs Position 7:2482913..2483504 Genome browser AA seq 165 aa AA seqDB search MAAEKEEVADAAAAGSGSDTILLISSDGEHFNVPSAAASLSQLVSNMIEDDCTTNGVPLP NVASKVLAKVIEYCIKHAAAGEEEEKDLKSFDAEFIDVDKNMLYDLLLASNFMNIKSLLD LCCQHTANLIKGKSPEQIRKEFGIKNDFTPEEEEEIRKENTWAFE NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggcggcagagaaggaggaggttgccgacgccgccgccgccggcagcggcagcgacaca atcctcctaatcagctccgacggcgagcacttcaacgtgccgtcggcggcggcgagcctg tcacagctcgtctccaacatgatcgaggacgactgcacgacgaacggggtgcctctcccc aacgtcgcctccaaggtcctcgccaaggtcatcgaatactgcatcaagcacgccgccgcc ggggaggaggaggagaaggatctgaagagcttcgacgccgagttcatcgacgtggacaag aacatgctgtacgatctgctcctggcgtccaatttcatgaacatcaagagcttgctggat ttgtgctgccagcacacggcgaacctgatcaaaggcaagtcgccggagcagatcaggaag gagtttgggatcaagaacgacttcacgccggaggaggaggaggaaatccgcaaggagaac acatgggccttcgagtag

DBGET integrated database retrieval system