KEGG   Oryza glaberrima (African rice): 127780513
Entry
127780513         CDS       T08853                                 
Name
(RefSeq) SKP1-like protein 11
  KO
K03094  S-phase kinase-associated protein 1
Organism
ogl  Oryza glaberrima (African rice)
Pathway
ogl03083  Polycomb repressive complex
ogl04120  Ubiquitin mediated proteolysis
ogl04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ogl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    127780513
   04120 Ubiquitin mediated proteolysis
    127780513
  09126 Chromosome
   03083 Polycomb repressive complex
    127780513
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ogl04131]
    127780513
   04121 Ubiquitin system [BR:ogl04121]
    127780513
   03036 Chromosome and associated proteins [BR:ogl03036]
    127780513
Membrane trafficking [BR:ogl04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    127780513
Ubiquitin system [BR:ogl04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     127780513
   Cul7 complex
     127780513
Chromosome and associated proteins [BR:ogl03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     127780513
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     127780513
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 127780513
NCBI-ProteinID: XP_052163393
UniProt: I1QCD2
LinkDB
Position
7:23138567..23139471
AA seq 174 aa
MATGSGAAAAAAADAEEKESGSRMITLTSNEGKAFVVTEASARQSATIRSMVDDGGCVDK
GFPLPNVDSKTLARVIQYCDEHGNKEPHTVDERAALAKFDRDFIAELDADKAFLYDVTMA
ANYLHIQGLLALTTQCVADTIKGKTPEEIRTAFGIEYDLTAQDEKEIKEEDTHA
NT seq 525 nt   +upstreamnt  +downstreamnt
atggcgacggggagcggagcagcggcggcggcggcggcggatgcggaggagaaggagagc
ggcagcaggatgatcaccctgacgagcaacgagggcaaggcgttcgttgtgacggaggcg
tcggcgaggcagtccgcgaccatcaggagcatggtcgacgacggcggctgcgtcgacaag
ggcttcccgctccccaacgtcgactccaagaccctcgcgagggtgatccagtactgcgac
gagcacggcaacaaggagccccacaccgtcgacgagagagcggcgctcgccaagttcgac
agggacttcatcgccgagctggacgccgacaaggccttcctctacgacgtcaccatggcc
gccaactacctccacatccaagggctcctcgccctcaccacccagtgcgtcgccgacacc
atcaagggcaagacccccgaggagatccgcacggccttcggcatcgagtacgacctcacc
gcgcaggacgagaaggagatcaaggaggaggatactcacgcatga

DBGET integrated database retrieval system