Oryza glaberrima (African rice): 127784209 Help Entry 127784209         CDS       T08853                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism ogl  Oryza glaberrima (African rice) Pathway ogl03083   Polycomb repressive complex ogl04120   Ubiquitin mediated proteolysis ogl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ogl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127784209    04120 Ubiquitin mediated proteolysis     127784209   09126 Chromosome    03083 Polycomb repressive complex     127784209  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogl04131]     127784209    04121 Ubiquitin system [BR:ogl04121]     127784209    03036 Chromosome and associated proteins [BR:ogl03036]     127784209 Membrane trafficking [BR:ogl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     127784209 Ubiquitin system [BR:ogl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      127784209    Cul7 complex      127784209 Chromosome and associated proteins [BR:ogl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      127784209   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      127784209 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  127784209 NCBI-ProteinID:  XP_052167359 UniProt:  I1QMJ6 LinkDB All DBs Position 9:4920485..4921135 Genome browser AA seq 160 aa AA seqDB search MAAADGTTGEEVKKTIDLVSNDGERFEVARDAALLCKTLRWMIKGGYGRIPLPSVASPIL ARVVDYLARHAAAAAAMDDDGLDRFDRDFLAGVDQDTLFDLLLAANYLQADGLLDLACKK VAAMMTGKSPEQMREIFHIVNDLTPEEEKEIREDIAWALN NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggatggcaccaccggagaggaggtgaagaagacgatcgatctcgtcagc aacgacggcgagcggttcgaggtggcgagggacgcggcgctgctgtgcaagacgctccgg tggatgatcaagggcggctacggccggatcccgctccccagcgtcgcctccccgatcctc gccagggtcgtcgactacctcgcccggcatgccgccgccgccgccgccatggacgacgac ggcctcgacaggttcgaccgcgacttcctcgccggcgtcgaccaggacacgctgttcgac ctcctcctcgccgccaactacctccaggccgacggcctcctcgacctcgcctgcaagaag gtcgccgccatgatgaccggcaagtcgccggagcagatgcgggagatcttccacatcgtc aacgatctcacgccggaggaggagaaggagatccgggaggacatcgcttgggcgctcaac tag

DBGET integrated database retrieval system