Oryza glaberrima (African rice): 19493586 Help Entry 19493586          CDS       T08853                                  Symbol psbF, GN06_pgp044 Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism ogl  Oryza glaberrima (African rice) Pathway ogl00195   Photosynthesis ogl01100   Metabolic pathways Module ogl_M00161   Photosystem II ogl_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:ogl00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     19493586 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ogl00194]     19493586 (psbF) Photosynthesis proteins [BR:ogl00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     19493586 (psbF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  19493586 NCBI-ProteinID:  YP_009034112 UniProt:  A0A059UFM7 LinkDB All DBs Position Pltd:complement(60031..60150) Genome browser AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaccatagatcgaacctatcctatttttacagtgcgatggctggctgttcacggacta gctgtacctactgtttttttcttgggatcaatatcagcaatgcagttcatccaacgataa

DBGET integrated database retrieval system