Oncorhynchus gorbuscha (pink salmon): 123989506 Help Entry 123989506         CDS       T07892                                  Name (RefSeq) claudin-14-like   KO K06087   claudin Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo03272   Virion - Hepatitis viruses ogo04382   Cornified envelope formation ogo04514   Cell adhesion molecule (CAM) interaction ogo04530   Tight junction Brite KEGG Orthology (KO) [BR:ogo00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     123989506  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     123989506  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     123989506  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     123989506  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ogo03037]     123989506    04147 Exosome [BR:ogo04147]     123989506 Cilium and associated proteins [BR:ogo03037]  Other cilia and associated proteins   Stereociliary proteins    123989506 Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    123989506   Exosomal proteins of colorectal cancer cells    123989506 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  123989506 NCBI-ProteinID:  XP_046146570 LinkDB All DBs Position LG01:94758757..94759516 Genome browser AA seq 164 aa AA seqDB search MASMTVQLLGFFLGLLGLVGSVVATVLPHWWQTAYVGSNIITATAYMKGLWMECVWHSTG IYQCEVHRSMLALPPDLQAARALMLLSCLTSTLAALVSSAGMKCTRCARGSSIKHVLAIS GGVCFLSAGMLCLITVCWTTNDVILDFYNPILPEVMKYEIGMAV NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atggccagcatgacggtccagctgctgggcttcttcctgggtctgctggggcttgtgggt agtgtagttgctacagtgctcccccactggtggcagacggcctatgtgggctctaacata atcacagccactgcctacatgaaggggctctggatggagtgtgtgtggcacagcacgggc atctaccagtgtgaagtacatcgctcaatgctggctctgccacctgacctgcaggcggca cgggcgttgatgttgctgtcctgcctgacctccaccctggcagccctcgtgtcctctgca gggatgaagtgtacccgctgtgcccgtggctcgtccatcaagcatgtcctggccatcagt gggggggtctgcttcctgtctgcaggcatgctctgcctaatcactgtctgctggacaacc aatgatgtcatcctcgacttctacaaccccatcctacctgaagttatgaagtatgagatt ggcatggcggtgtag

DBGET integrated database retrieval system