Oncorhynchus gorbuscha (pink salmon): 123990307 Help Entry 123990307         CDS       T07892                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ogo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     123990307  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ogo04121]     123990307    03400 DNA repair and recombination proteins [BR:ogo03400]     123990307 Ubiquitin system [BR:ogo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      123990307    Cul5 complex      123990307 DNA repair and recombination proteins [BR:ogo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      123990307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  123990307 NCBI-ProteinID:  XP_046146856 LinkDB All DBs Position LG12:complement(80684258..80686753) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggtgaagagaagacctacggtggctgtgaaggcccagatgccatgtatgtgaag ctgatctcttctgatggccatgagttcatagtgaagagagaacacgccttgacctcaggg accatcaaagccatgttgagtggaccaggtcagtttgcagagaatgaaaccaacgaagtg aacttcagagagatcccctcccatgtcctgtccaaggtgtgcatgtacttcacctacaag gtccgctacaccaacagctccacggagatcccagagttccccatcgccccggagatcgcc ctggaactactcatggctgccaacttcctggattgttag

DBGET integrated database retrieval system