Oncorhynchus gorbuscha (pink salmon): 123995144 Help Entry 123995144         CDS       T07892                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04010   MAPK signaling pathway ogo04068   FoxO signaling pathway ogo04081   Hormone signaling ogo04114   Oocyte meiosis ogo04140   Autophagy - animal ogo04150   mTOR signaling pathway ogo04810   Regulation of actin cytoskeleton ogo04910   Insulin signaling pathway ogo04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ogo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123995144    04068 FoxO signaling pathway     123995144    04150 mTOR signaling pathway     123995144   09133 Signaling molecules and interaction    04081 Hormone signaling     123995144  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123995144   09143 Cell growth and death    04114 Oocyte meiosis     123995144   09142 Cell motility    04810 Regulation of actin cytoskeleton     123995144  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     123995144    04914 Progesterone-mediated oocyte maturation     123995144  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ogo04052]     123995144 Cytokines and neuropeptides [BR:ogo04052]  Neuropeptides   Unclassified    123995144 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  123995144 NCBI-ProteinID:  XP_046154489 LinkDB All DBs Position LG02:103390335..103391610 Genome browser AA seq 142 aa AA seqDB search MGGESGVLPQPTFPSAFLLLFYRASSPPPPQPIINMALWLQTASLLVLLALYPGADAAAA QHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLTGFLFPKSSQENEVAEYPFKDQMDMIVK RGIVEQCCHKPCNIFDLQNYCN NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggggggagaatctggtgttctgcctcaaccaacttttccctcagcatttctgctactc ttctacagagcttcttcaccaccacctccacagcccatcatcaacatggccctctggctc caaactgcatctctgctggtgctgctggccctctaccctggggcagacgctgcagctgcc caacacctgtgtggctctcatctggtggatgccctctatctggtgtgtggagagaaagga ttcttttacaacccaaagagagatgtggatcccctaacagggtttctctttccaaaatcg tcccaggagaacgaagttgccgagtacccgttcaaagaccagatggacatgatagtaaag agaggtattgtagagcagtgctgtcacaagccttgcaacatcttcgacctgcagaactac tgcaactga

DBGET integrated database retrieval system