Oncorhynchus gorbuscha (pink salmon): 123998222 Help Entry 123998222         CDS       T07892                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04382   Cornified envelope formation ogo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ogo00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     123998222  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123998222  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogo04147]     123998222 Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of microglial cells    123998222 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 Astro_p19 DUF826 Motif Other DBs NCBI-GeneID:  123998222 NCBI-ProteinID:  XP_046159210 LinkDB All DBs Position LG15:complement(82101228..82102849) Genome browser AA seq 101 aa AA seqDB search MPSELERSMESLIMVFHRYSEKDGDGNTLSKKELKELMKTELASFLKSQKDPAAIDTIMK DLDQNGDGKVNFEEFVSLVVGLSIACEQLYQLHTMKASAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgagttggagcgttccatggagtccctgatcatggtgttccatcgctattct gaaaaggatggtgacggcaacacactgagcaagaaggagctgaaagagctgatgaagaca gaactggccagcttcctgaagtcccagaaggacccagccgccatagacacgatcatgaag gatctggaccagaatggtgatgggaaggtaaactttgaggagtttgtctccctggtggtg ggcctctccattgcctgtgaacagctctaccagctccacaccatgaaggcttctgccaag aagtga

DBGET integrated database retrieval system