Oncorhynchus gorbuscha (pink salmon): 124002027 Help Entry 124002027         CDS       T07892                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04010   MAPK signaling pathway ogo04012   ErbB signaling pathway ogo04068   FoxO signaling pathway ogo04137   Mitophagy - animal ogo04140   Autophagy - animal ogo04144   Endocytosis ogo04150   mTOR signaling pathway ogo04210   Apoptosis ogo04218   Cellular senescence ogo04370   VEGF signaling pathway ogo04371   Apelin signaling pathway ogo04510   Focal adhesion ogo04540   Gap junction ogo04625   C-type lectin receptor signaling pathway ogo04810   Regulation of actin cytoskeleton ogo04910   Insulin signaling pathway ogo04912   GnRH signaling pathway ogo04916   Melanogenesis ogo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ogo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124002027    04012 ErbB signaling pathway     124002027    04370 VEGF signaling pathway     124002027    04371 Apelin signaling pathway     124002027    04068 FoxO signaling pathway     124002027    04150 mTOR signaling pathway     124002027  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124002027    04140 Autophagy - animal     124002027    04137 Mitophagy - animal     124002027   09143 Cell growth and death    04210 Apoptosis     124002027    04218 Cellular senescence     124002027   09144 Cellular community - eukaryotes    04510 Focal adhesion     124002027    04540 Gap junction     124002027   09142 Cell motility    04810 Regulation of actin cytoskeleton     124002027  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124002027   09152 Endocrine system    04910 Insulin signaling pathway     124002027    04912 GnRH signaling pathway     124002027    04916 Melanogenesis     124002027  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124002027  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogo04131]     124002027   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogo04147]     124002027    04031 GTP-binding proteins [BR:ogo04031]     124002027 Membrane trafficking [BR:ogo04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     124002027  Endocytosis   Macropinocytosis    Ras GTPases     124002027 Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    124002027   Exosomal proteins of colorectal cancer cells    124002027 GTP-binding proteins [BR:ogo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124002027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin G-alpha AAA_16 Motif Other DBs NCBI-GeneID:  124002027 NCBI-ProteinID:  XP_046165198 LinkDB All DBs Position LG02:complement(38388562..38420077) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggcaggaggtgtggggaagagtgcactcacc atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccaatacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggaacagatc aagcgtgtgaaggactctgacgacgtaccgatggtgctggtgggtaataaatgtgacctc ccggcttgtaccgtggacacgcggcaagcccaagaactggcccgcagctatggaattccc tacattgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc agagagatcaggcaacacaagctgaggaagctcaaccctccggacgagagtgggcaggac tgcatgagctgccgctgtgtggtgtcttga

DBGET integrated database retrieval system