Oncorhynchus gorbuscha (pink salmon): 124006964 Help Entry 124006964         CDS       T07892                                  Name (RefSeq) metallothionein B   KO K14739   metallothionein 1/2 Organism ogo  Oncorhynchus gorbuscha (pink salmon) Brite KEGG Orthology (KO) [BR:ogo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ogo03019]     124006964    03029 Mitochondrial biogenesis [BR:ogo03029]     124006964 Messenger RNA biogenesis [BR:ogo03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      124006964 Mitochondrial biogenesis [BR:ogo03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     124006964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  124006964 NCBI-ProteinID:  XP_046173162 LinkDB All DBs Position LG01:38844241..38845432 Genome browser AA seq 60 aa AA seqDB search MDPCECSKTGSCNCGGSCKCSNCACTSCKKSCCPCCPSDCSKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgtgaatgctctaaaactggctcttgcaactgcggtggatcctgcaagtgc tcaaactgcgcatgcaccagttgtaagaaaagttgctgcccctgctgtccttccgactgc agtaaatgtgcttcaggctgtgtgtgcaagggcaagacctgtgacaccagctgttgtcag tga

DBGET integrated database retrieval system