Oncorhynchus gorbuscha (pink salmon): 124007002 Help Entry 124007002         CDS       T07892                                  Symbol zgc:100918 Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04137   Mitophagy - animal ogo04140   Autophagy - animal ogo04144   Endocytosis ogo04145   Phagosome ogo04148   Efferocytosis ogo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ogo00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124007002 (zgc:100918)    04145 Phagosome     124007002 (zgc:100918)    04140 Autophagy - animal     124007002 (zgc:100918)    04137 Mitophagy - animal     124007002 (zgc:100918)    04148 Efferocytosis     124007002 (zgc:100918)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124007002 (zgc:100918)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogo04131]     124007002 (zgc:100918)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogo04147]     124007002 (zgc:100918)    04031 GTP-binding proteins [BR:ogo04031]     124007002 (zgc:100918) Membrane trafficking [BR:ogo04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     124007002 (zgc:100918) Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124007002 (zgc:100918)   Exosomal proteins of other body fluids (saliva and urine)    124007002 (zgc:100918)   Exosomal proteins of colorectal cancer cells    124007002 (zgc:100918)   Exosomal proteins of bladder cancer cells    124007002 (zgc:100918) GTP-binding proteins [BR:ogo04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     124007002 (zgc:100918) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW PduV-EutP ATP_bind_1 nSTAND3 Septin AAA_16 NTPase_1 AAA_22 AAA_7 DUF5992 AAA_24 G-alpha AAA_5 SRPRB ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  124007002 NCBI-ProteinID:  XP_046173188 LinkDB All DBs Position LG20:complement(6386856..6396913) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKSSIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPADPSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacttctctgatgaaccagtatgtaaataagaagttcagtaaccagtacaaggccact ataggagcggacttcctcaccaaggaggtgatggtggacgacaggctggtcaccatgcag atctgggacacggcggggcaggagcgtttccagtctctgggcgtggcgttctaccgcggc gctgactgctgtgtgctggtctacgatgtcacggcgcccaacaccttcaagacactggac agctggagggatgagttcctgattcaggccagccccagagacccagacaacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacgacaaaacgtgcccag gcctggtgtgccagtaagagcagcatcccctactttgagaccagcgccaaggaggccatc aacgtagaccaagcattccagaccattgcccgcaatgcccttaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgaccggcccgccgaccccagc gacggctgctcctgctga

DBGET integrated database retrieval system