Oncorhynchus gorbuscha (pink salmon): 124011373 Help Entry 124011373         CDS       T07892                                  Name (RefSeq) ras-related protein M-Ras-like   KO K07831   Ras-related protein M-Ras Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04010   MAPK signaling pathway ogo04137   Mitophagy - animal ogo04140   Autophagy - animal ogo04218   Cellular senescence ogo04371   Apelin signaling pathway ogo04625   C-type lectin receptor signaling pathway ogo04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ogo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124011373    04371 Apelin signaling pathway     124011373  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124011373    04137 Mitophagy - animal     124011373   09143 Cell growth and death    04218 Cellular senescence     124011373   09142 Cell motility    04810 Regulation of actin cytoskeleton     124011373  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124011373  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ogo04031]     124011373 GTP-binding proteins [BR:ogo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124011373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 GTP_EFTU AAA_16 RsgA_GTPase Septin AAA_24 Motif Other DBs NCBI-GeneID:  124011373 NCBI-ProteinID:  XP_046180643 LinkDB All DBs Position LG23:complement(55652199..55668262) Genome browser AA seq 161 aa AA seqDB search MAVTMATSTVLSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEI DAQWAILDVLDTAGQEEFSAMREQYMRTGEGFLIVFSVTDKASFEHVDCFHQLILRVKDR WDLLLNFPLVAVARTTGGGERMCLFVLESVGLSDNREKKRK NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggctgtcactatggcaacgagcactgttctcagcgacaatctccccacgtataagctg gtagtggtgggggatgggggagtggggaagagtgctctcaccattcagttctttcagaag atctttgtccctgattatgaccccaccatcgaggactcctacctcaaacacactgagatt gatgcccagtgggccatattggacgttctggatacagcaggccaagaggagttcagtgct atgagggaacagtacatgaggactggggaagggttcctcatcgtgttctctgtcacagac aaggccagctttgaacatgtggactgcttccatcaactcatcctcagggtgaaggaccgg tgggatttactacttaacttcccactggtggccgtggccaggacaacaggaggaggggag aggatgtgtctgtttgtgttagaatcagtgggcctgtcagacaacagagagaagaagaga aagtga

DBGET integrated database retrieval system