Oncorhynchus gorbuscha (pink salmon): 124015116 Help Entry 124015116         CDS       T07892                                  Symbol bbip1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism ogo  Oncorhynchus gorbuscha (pink salmon) Brite KEGG Orthology (KO) [BR:ogo00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ogo03037]     124015116 (bbip1) Cilium and associated proteins [BR:ogo03037]  Primary cilia and associated proteins   BBSome    124015116 (bbip1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 SIN1 HicB-like_2 Motif Other DBs NCBI-GeneID:  124015116 NCBI-ProteinID:  XP_046186021 LinkDB All DBs Position LG26:complement(2844479..2845899) Genome browser AA seq 69 aa AA seqDB search MPEVKSMFREVLPKQGQLSMEDVPTMVLCKPKLMPLKSVTLEKLEKMQLEAQEAIKQQDL ALKEQQETQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcctgaagtcaaatcgatgttcagagaagtgctgcccaaacaagggcagttgtccatg gaggatgtccccaccatggtgctgtgtaagcccaagctgatgcctctgaaatcagtcacc ctggagaaactggagaagatgcaactggaggcccaggaggccatcaagcaacaggatctg gcactgaaagagcagcaggagacacagtag

DBGET integrated database retrieval system