Oncorhynchus gorbuscha (pink salmon): 124015158 Help Entry 124015158         CDS       T07892                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ogo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124015158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ogo04121]     124015158    03400 DNA repair and recombination proteins [BR:ogo03400]     124015158 Ubiquitin system [BR:ogo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      124015158    Cul5 complex      124015158 DNA repair and recombination proteins [BR:ogo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124015158 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  124015158 NCBI-ProteinID:  XP_046186104 LinkDB All DBs Position LG26:complement(40754094..40758587) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcacaagacgaccatcttcactgatgccaaagag tccactacggtctacgaactgaagcgcatagtggagggtatcctaaagagggcaccggag gaacagaggctgtacaaggacgacatgttgctggaggatagtaagactcttggagactgt ggcttcacaaatcagacagccagacctcaggccccagggactgttggattagctttccgt ctcggtgatgatgcatttgaacagctgagggttgagcccttctccagccccccagagctt cctgatgtcatgaagcctcaggactctggcagcacagccaatgagcaggctgtgcagtga

DBGET integrated database retrieval system