Oncorhynchus gorbuscha (pink salmon): 124031444 Help Entry 124031444         CDS       T07892                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04137   Mitophagy - animal ogo04140   Autophagy - animal ogo04144   Endocytosis ogo04145   Phagosome ogo04148   Efferocytosis ogo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ogo00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124031444    04145 Phagosome     124031444    04140 Autophagy - animal     124031444    04137 Mitophagy - animal     124031444    04148 Efferocytosis     124031444  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124031444  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogo04131]     124031444   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogo04147]     124031444    04031 GTP-binding proteins [BR:ogo04031]     124031444 Membrane trafficking [BR:ogo04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     124031444 Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124031444   Exosomal proteins of other body fluids (saliva and urine)    124031444   Exosomal proteins of colorectal cancer cells    124031444   Exosomal proteins of bladder cancer cells    124031444 GTP-binding proteins [BR:ogo04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     124031444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_22 AAA_7 G-alpha AAA_24 AAA_5 NTPase_1 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  124031444 NCBI-ProteinID:  XP_046198636 LinkDB All DBs Position LG03:46971426..46978414 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVIVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERSKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaagtactacttaaagtcatcatcctgggagactctggagttggg aagacgtccctgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca attggagctgatttcctgacgaaagaagtgattgtggacgacaggcttgtcaccatgcag atctgggacacagcagggcaggagaggttccagtctctgggcgtggcgttttaccgcggg gcagactgttgcgtgctggtgtttgacgtgactgcccccaacaccttcaagaccctagac agctggagggacgagttcctcatacaggccagcccccgagaccccgagaacttccccttc gtggtgctaggcaacaagattgacctggagaacagacaggtgacgactaaacgagcacag gcctggtgtcagagcaagaacaacatcccctacttcgagaccagcgctaaggaggccatc aacgttgaacaggctttccagactattgcacgcaatgctcttaaacaggagacagaggtg gagttgtacaatgagttccctgaaccgataaagctggacaggaacgaacgttccaagcca tcagcggaggcctgcagctgctga

DBGET integrated database retrieval system