Oncorhynchus gorbuscha (pink salmon): 124035184 Help Entry 124035184         CDS       T07892                                  Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04010   MAPK signaling pathway ogo04012   ErbB signaling pathway ogo04068   FoxO signaling pathway ogo04137   Mitophagy - animal ogo04140   Autophagy - animal ogo04150   mTOR signaling pathway ogo04210   Apoptosis ogo04218   Cellular senescence ogo04370   VEGF signaling pathway ogo04371   Apelin signaling pathway ogo04540   Gap junction ogo04625   C-type lectin receptor signaling pathway ogo04810   Regulation of actin cytoskeleton ogo04910   Insulin signaling pathway ogo04912   GnRH signaling pathway ogo04914   Progesterone-mediated oocyte maturation ogo04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ogo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124035184    04012 ErbB signaling pathway     124035184    04370 VEGF signaling pathway     124035184    04371 Apelin signaling pathway     124035184    04068 FoxO signaling pathway     124035184    04150 mTOR signaling pathway     124035184  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124035184    04137 Mitophagy - animal     124035184   09143 Cell growth and death    04210 Apoptosis     124035184    04218 Cellular senescence     124035184   09144 Cellular community - eukaryotes    04540 Gap junction     124035184   09142 Cell motility    04810 Regulation of actin cytoskeleton     124035184  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124035184   09152 Endocrine system    04910 Insulin signaling pathway     124035184    04912 GnRH signaling pathway     124035184    04914 Progesterone-mediated oocyte maturation     124035184    04916 Melanogenesis     124035184  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ogo04131]     124035184   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ogo04031]     124035184 Membrane trafficking [BR:ogo04131]  Endocytosis   Macropinocytosis    Ras GTPases     124035184 GTP-binding proteins [BR:ogo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124035184 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  124035184 NCBI-ProteinID:  XP_046204570 LinkDB All DBs Position LG01:24429797..24442577 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC IKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtggtggtgggagcaggaggtgtgggcaagagcgcgctcacc atccagctcattcagaaccactttgtggatgaatatgaccccaccatcgaggactcgtac aggaagcaggtggtgattgatggggagacatgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccaatacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaggacatccaccactacagagagcagatc aagcgggtgaaagactcagaagacgtgccaatggtgctggtggggaacaagtgtgacctg ccgtcccggacggtggacaccaaacaggctcaggacttagcgcgcagctacggcatcccc ttcattgagacctcggccaaaacgagacagagagtggaggatgccttttacagtctggta cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc atcaagcttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system