Opisthocomus hoazin (hoatzin): 104326741 Help Entry 104326741         CDS       T08436                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04060   Cytokine-cytokine receptor interaction oha04217   Necroptosis oha04620   Toll-like receptor signaling pathway oha04621   NOD-like receptor signaling pathway oha04622   RIG-I-like receptor signaling pathway oha04623   Cytosolic DNA-sensing pathway oha05164   Influenza A oha05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104326741  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104326741  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104326741    04621 NOD-like receptor signaling pathway     104326741    04622 RIG-I-like receptor signaling pathway     104326741    04623 Cytosolic DNA-sensing pathway     104326741  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104326741    05168 Herpes simplex virus 1 infection     104326741  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oha04052]     104326741 Cytokines and neuropeptides [BR:oha04052]  Cytokines   Interferons    104326741 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  104326741 NCBI-ProteinID:  XP_009929851 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MIIYEFLQQIFQLFSKNLPAGTWNASKIEKFQNRIHQQIEELETCLLEDTTLSVKRYFQR ITSFLKDKQYSQCSWQAVQMELRTCLIIFDSLMKKHMS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatcatctatgagttcctccaacagatcttccaactatttagcaaaaatcttcctgct ggtacttggaatgcaagcaagattgagaaatttcaaaacagaattcatcagcaaattgaa gaattagagacatgtttgttagaagatactaccctcagcgtgaaaaggtacttccaaaga atcaccagtttcctaaaagataagcaatacagccagtgttcctggcaagcagtccaaatg gaactgaggacatgccttataatttttgacagtctgatgaaaaaacacatgtcataa

DBGET integrated database retrieval system