Opisthocomus hoazin (hoatzin): 104328221 Help Entry 104328221         CDS       T08436                                  Symbol PROK1 Name (RefSeq) prokineticin-1   KO K24191   prokineticin Organism oha  Opisthocomus hoazin (hoatzin) Brite KEGG Orthology (KO) [BR:oha00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oha04052]     104328221 (PROK1) Cytokines and neuropeptides [BR:oha04052]  Cytokines   Chemokines    104328221 (PROK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prokineticin Motif Other DBs NCBI-GeneID:  104328221 NCBI-ProteinID:  XP_009931518 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MGRLLLTLCLLLLITPCPCAIITGVPFFGKRQHHTCPCLPNFSCSRFLHGRYRCSVDFKN IDF NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgggccggctcctgctcaccctctgcttgctcctgctcatcaccccctgcccctgcgct atcatcaccggggtccctttcttcgggaagcgccagcaccacacctgcccgtgtttgccc aacttcagctgctccaggttcctccacggccgctaccgctgctccgtcgacttcaagaac attgatttttag

DBGET integrated database retrieval system