Opisthocomus hoazin (hoatzin): 104330120 Help Entry 104330120         CDS       T08436                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04010   MAPK signaling pathway oha04068   FoxO signaling pathway oha04081   Hormone signaling oha04114   Oocyte meiosis oha04140   Autophagy - animal oha04150   mTOR signaling pathway oha04810   Regulation of actin cytoskeleton oha04910   Insulin signaling pathway oha04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104330120 (INS)    04068 FoxO signaling pathway     104330120 (INS)    04150 mTOR signaling pathway     104330120 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104330120 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104330120 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104330120 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104330120 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104330120 (INS)    04914 Progesterone-mediated oocyte maturation     104330120 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oha04052]     104330120 (INS) Cytokines and neuropeptides [BR:oha04052]  Neuropeptides   Unclassified    104330120 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104330120 NCBI-ProteinID:  XP_009933593 UniProt:  A0A091W867 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIQLLPLLALLALSSSRTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ SLASSPLHSEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccaattgctgcctctcctggcccttctcgctctttccagctccagg accagccatgcggctgccaaccagcacctctgcggctcgcacttggtggaggctctctac ctggtgtgtggagagcgaggtttcttctactccccaaaagcccgacgggacattgagcag tctctagcaagcagtcccttgcacagtgaggtaggagagctgcccttccagcaggaggag tttgagaaagtgaagcgagggatcgtcgagcaatgctgccacaacacgtgctccctctac caactggaaaactactgcaactaa

DBGET integrated database retrieval system