Opisthocomus hoazin (hoatzin): 104330137 Help Entry 104330137         CDS       T08436                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04010   MAPK signaling pathway oha04137   Mitophagy - animal oha04140   Autophagy - animal oha04218   Cellular senescence oha04371   Apelin signaling pathway oha04519   Cadherin signaling oha04625   C-type lectin receptor signaling pathway oha04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104330137 (RRAS2)    04371 Apelin signaling pathway     104330137 (RRAS2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     104330137 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104330137 (RRAS2)    04137 Mitophagy - animal     104330137 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     104330137 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104330137 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104330137 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oha04147]     104330137 (RRAS2)    04031 GTP-binding proteins [BR:oha04031]     104330137 (RRAS2) Exosome [BR:oha04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104330137 (RRAS2)   Exosomal proteins of bladder cancer cells    104330137 (RRAS2) GTP-binding proteins [BR:oha04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104330137 (RRAS2) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 RHG35-p190PhoGP_pG1 Motif Other DBs NCBI-GeneID:  104330137 NCBI-ProteinID:  XP_009933614 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MSVLYVLILHTNLSYFLQSYFVTDYDPTIEDSYTKQCVIDERAARLDILDTAGQEEFGAM REQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQVT QEEGQQLARQLKVTYMEASAKIRLNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKG CHCVIF NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgagtgtgttgtatgtgctcatcttacacacaaacttgtcttattttctgcagtcctat tttgttacggattatgatccaacgattgaagactcctacaccaagcaatgtgtgatagat gaaagagcggcacgcttggacattttggatacagcgggacaagaagaatttggagccatg cgtgaacagtacatgaggacaggggagggttttctgcttgttttctcagtcaccgataga ggaagttttgaagaaatctataagtttcagcgacaaattcttagagtgaaagatcgcgat gagtttcctatgattctagttggtaataaagcagatctggaccaccaaagacaggtgaca caagaggaaggtcagcagctagcacggcaacttaaagtaacgtacatggaagcctctgca aaaatcagattgaatgtagaccaagcttttcatgaacttgtcagagttataaggaaattt caagaacaagagtgccctccttcaccagagccaacacggaaagaaaaagacaagaaaggc tgccattgtgttattttctga

DBGET integrated database retrieval system