Opisthocomus hoazin (hoatzin): 104331326 Help Entry 104331326         CDS       T08436                                  Name (RefSeq) caltrin-like protein 2   KO K23642   elafin Organism oha  Opisthocomus hoazin (hoatzin) Brite KEGG Orthology (KO) [BR:oha00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:oha01002]     104331326 Peptidases and inhibitors [BR:oha01002]  Peptidase inhibitors   Family I17: WAP-type family    104331326 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  WAP Motif Other DBs NCBI-GeneID:  104331326 NCBI-ProteinID:  XP_009934923 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MKSVAALLLVGMLILWTELPTGSAWSCPPVRITCMMVNPPNKCNTDQDCPRHTKCCRSYC GRRCISRPSSIPVFY NT seq 226 nt NT seq  +upstreamnt  +downstreamnt atgaagtcggtggccgcccttctcctggtggggatgctcatcctctggacagagctgccg acaggcagcgcctggtcctgcccacccgtccgcatcacctgcatgatggtcaacccacca aacaagtgcaacactgatcaggattgtccacggcacacaaagtgctgcaggtcctactgt gggcggagatgcatctcacgtccatcttccatccctgtcttctacg

DBGET integrated database retrieval system